VAMP4 Monoclonal antibody

• 

  WB analysis using 67219-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67219-1-Ig (VAMP4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 67219-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67219-1-Ig (VAMP4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 67219-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67219-1-Ig (VAMP4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 67219-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67219-1-Ig (VAMP4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 67219-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 67219-1-Ig (VAMP4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 67219-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using 67219-1-Ig (VAMP4 antibody), at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

VAMP4 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67219-1-Ig

Clone No.3A6F2

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

3A6F2, VAMP-4, Vesicle-associated membrane protein 4

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, K-562 cells, pig brain tissue, rat brain tissue
• Positive IHC detected in: mouse cerebellum tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

67219-1-Ig targets VAMP4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27854

  Product name: Recombinant human VAMP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC007019

  Sequence: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT

• Full Name: vesicle-associated membrane protein 4
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC007019
• Gene Symbol: VAMP4
• Gene ID (NCBI): 8674
• RRID: AB_2882510
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75379
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VAMP4 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP4 may play a role in trans-Golgi network to endosome transport.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	eNeuro; ADP ribosylation factor 4 (Arf4) regulates radial migration through N-cadherin trafficking during cerebral cortical development; Authors - Yoshinobu Hara