Tested Applications
Positive WB detected in | MCF-7 cells, HepG2 cells, HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
67273-1-Ig targets VANGL2 in WB, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Cited Reactivity | hamster |
Host / Isotype | Mouse / IgG3 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16980 Product name: Recombinant human VANGL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 268-322 aa of BC103920 Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ Predict reactive species |
Full Name | vang-like 2 (van gogh, Drosophila) |
Calculated Molecular Weight | 521 aa, 60 kDa |
Observed Molecular Weight | 60 kDa |
GenBank Accession Number | BC103920 |
Gene Symbol | VANGL2 |
Gene ID (NCBI) | 57216 |
RRID | AB_2882542 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9ULK5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Vangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for VANGL2 antibody 67273-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |