VANGL2 Monoclonal antibody

• 

  WB analysis of MCF-7 using 67273-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67273-1-Ig (VANGL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67273-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67273-1-Ig (VANGL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67273-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67273-1-Ig (VANGL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

VANGL2 Monoclonal Antibody for WB, ELISA

Cat No. 67273-1-Ig

Clone No.1B2C1

Publications(1)

Host / Isotype

Mouse / IgG3

Reactivity

Human and More (1)

Applications

WB, ELISA

Synonyms

KIAA1215, Loop tail protein 1 homolog, LPP1, LTAP, STB1, STBM, STBM1, Strabismus 1, Van Gogh like protein 2, Vang like protein 2, VANGL2

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

67273-1-Ig targets VANGL2 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: hamster
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16980

  Product name: Recombinant human VANGL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 268-322 aa of BC103920

  Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ

• Full Name: vang-like 2 (van gogh, Drosophila)
• Calculated Molecular Weight: 521 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC103920
• Gene Symbol: VANGL2
• Gene ID (NCBI): 57216
• RRID: AB_2882542
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULK5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
hamster	WB	Biochim Biophys Acta Gene Regul Mech; MicroRNA-27a-3p targeting Vangl1 and Vangl2 inhibits cell proliferation in mouse granulosa cells; Authors - Hu Tao ; KD Validated