Product Information
67273-1-PBS targets VANGL2 in WB, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG3 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16980 Product name: Recombinant human VANGL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 268-322 aa of BC103920 Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ Predict reactive species |
Full Name | vang-like 2 (van gogh, Drosophila) |
Calculated Molecular Weight | 521 aa, 60 kDa |
Observed Molecular Weight | 60 kDa |
GenBank Accession Number | BC103920 |
Gene Symbol | VANGL2 |
Gene ID (NCBI) | 57216 |
RRID | AB_2882542 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9ULK5 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Vangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin.