Product Information
67273-1-PBS targets VANGL2 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG3 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16980 Product name: Recombinant human VANGL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 268-322 aa of BC103920 Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ Predict reactive species |
| Full Name | vang-like 2 (van gogh, Drosophila) |
| Calculated Molecular Weight | 521 aa, 60 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC103920 |
| Gene Symbol | VANGL2 |
| Gene ID (NCBI) | 57216 |
| RRID | AB_2882542 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9ULK5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Vangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin.





