VANGL2 Monoclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 67273-1-Ig (same clone as 67273-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67273-1-Ig (VANGL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67273-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67273-1-Ig (same clone as 67273-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67273-1-Ig (VANGL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67273-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67273-1-Ig (same clone as 67273-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67273-1-Ig (VANGL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67273-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

VANGL2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67273-1-PBS

Clone No.1B2C1

Host / Isotype

Mouse / IgG3

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

LTAP, LPP1, Loop-tail protein 1 homolog, Loop tail protein 1 homolog, KIAA1215

---

Product Information

67273-1-PBS targets VANGL2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16980

  Product name: Recombinant human VANGL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 268-322 aa of BC103920

  Sequence: IQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQ

• Full Name: vang-like 2 (van gogh, Drosophila)
• Calculated Molecular Weight: 521 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC103920
• Gene Symbol: VANGL2
• Gene ID (NCBI): 57216
• RRID: AB_2882542
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULK5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Vangl2 is a key component of the planar cell polarity (PCP) pathway. Vangl2 is tightly associated with the postsynaptic density (PSD) fraction and forms a protein complex with PSD-95 and NMDA receptors. Vangl2 directly binds to the third PDZ domain of PSD-95 via its C-terminal TSV motif. Vangl2 directly binds to N-cadherin.