Tested Applications
| Positive WB detected in | A431 cells, bEnd.3 cells, C6 cells, Jurkat cells, MCF-7 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human lung cancer tissue, human liver cancer tissue, mouse kidney tissue, mouse liver tissue, mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver cancer tissue |
| Positive IF/ICC detected in | HeLa cells, MCF-7 cells, NIH/3T3 cells |
| Positive FC (Intra) detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19003-1-AP targets VEGFA in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, rabbit, monkey, bovine, sheep, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13500 Product name: Recombinant human VEGFA protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-302 aa of BC065522 Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR Predict reactive species |
| Full Name | vascular endothelial growth factor A |
| Calculated Molecular Weight | 412 aa, 46 kDa |
| Observed Molecular Weight | 36-40 kDa |
| GenBank Accession Number | BC065522 |
| Gene Symbol | VEGFA |
| Gene ID (NCBI) | 7422 |
| RRID | AB_2212657 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15692 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VEGFA, also named VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38 kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ). This antibody can recognize all VEGFA isoforms.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for VEGFA antibody 19003-1-AP | Download protocol |
| IF protocol for VEGFA antibody 19003-1-AP | Download protocol |
| IHC protocol for VEGFA antibody 19003-1-AP | Download protocol |
| IP protocol for VEGFA antibody 19003-1-AP | Download protocol |
| WB protocol for VEGFA antibody 19003-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Nanotechnol Long-term pulmonary exposure to multi-walled carbon nanotubes promotes breast cancer metastatic cascades.
| ||
Bioact Mater A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds | ||
ACS Nano Mesenchymal Stem Cell-Derived Extracellular Vesicles Attenuate Mitochondrial Damage and Inflammation by Stabilizing Mitochondrial DNA. | ||
Adv Sci (Weinh) Paracrine Orchestration of Tumor Microenvironment Remodeling Induced by GLO1 Potentiates Lymph Node Metastasis in Breast Cancer | ||
Adv Sci (Weinh) Semaphorin 3E-Plexin-D1 Pathway Downstream of the Luteinizing Hormone Surge Regulates Ovulation, Granulosa Cell Luteinization, and Ovarian Angiogenesis in Mice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Shriya (Verified Customer) (08-27-2025) | Anti VEGFA antibody- very sensitive and gives me good results for my tumor cells
|
FH Angie (Verified Customer) (07-24-2024) | WB result of VEGFA antibody (used at 1:5000) incubated at room temperature for 1.5 hours. Two stronger bands between 35-50 kDa were observed.
![]() |
FH Alexandru (Verified Customer) (11-21-2023) | Great antibody with clear and specific signal, would buy again!
|
FH Fiona (Verified Customer) (07-16-2019) | Good quality antibody and good value for money. Would purchase again.
![]() |



















































