• Featured Product
  • KD/KO Validated

VEGFA Polyclonal antibody

The VEGFA polyclonal antibody (19003-1-AP) is one of the most highly cited VEGFA antibodies in the market. It is suitable for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA and has been referenced in over 961 publications.

Cat No. 19003-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (7)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA

VEGF, L-VEGF, N-VEGF, Vascular Endothelial Growth Factor, vascular endothelial growth factor A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, bEnd.3 cells, C6 cells, Jurkat cells, MCF-7 cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman lung cancer tissue, human liver cancer tissue, mouse kidney tissue, mouse liver tissue, mouse lung tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver cancer tissue
Positive IF/ICC detected inHeLa cells, MCF-7 cells, NIH/3T3 cells
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19003-1-AP targets VEGFA in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, rabbit, monkey, bovine, sheep, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13500

Product name: Recombinant human VEGFA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-302 aa of BC065522

Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Predict reactive species
Full Name vascular endothelial growth factor A
Calculated Molecular Weight 412 aa, 46 kDa
Observed Molecular Weight36-40 kDa
GenBank Accession NumberBC065522
Gene Symbol VEGFA
Gene ID (NCBI) 7422
RRIDAB_2212657
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP15692
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VEGFA, also named VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38 kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ). This antibody can recognize all VEGFA isoforms.

Protocols

Product Specific Protocols
FC protocol for VEGFA antibody 19003-1-APDownload protocol
IF protocol for VEGFA antibody 19003-1-APDownload protocol
IHC protocol for VEGFA antibody 19003-1-APDownload protocol
IP protocol for VEGFA antibody 19003-1-APDownload protocol
WB protocol for VEGFA antibody 19003-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cancer Cell

Single-cell multi-stage spatial evolutional map of esophageal carcinogenesis

Authors - Jiang Chang
mouseWB,IHC

Nat Nanotechnol

Long-term pulmonary exposure to multi-walled carbon nanotubes promotes breast cancer metastatic cascades.

Authors - Xuefei Lu
  • KD Validated
humanWB

Bioact Mater

A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds

Authors - Shunlai Shang
mouse,humanWB

ACS Nano

Mesenchymal Stem Cell-Derived Extracellular Vesicles Attenuate Mitochondrial Damage and Inflammation by Stabilizing Mitochondrial DNA.

Authors - Meng Zhao
humanWB

Adv Sci (Weinh)

Paracrine Orchestration of Tumor Microenvironment Remodeling Induced by GLO1 Potentiates Lymph Node Metastasis in Breast Cancer

Authors - Jindong Xie
mouseWB

Adv Sci (Weinh)

Semaphorin 3E-Plexin-D1 Pathway Downstream of the Luteinizing Hormone Surge Regulates Ovulation, Granulosa Cell Luteinization, and Ovarian Angiogenesis in Mice

Authors - Hanxue Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Shriya (Verified Customer) (08-27-2025)

Anti VEGFA antibody- very sensitive and gives me good results for my tumor cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Human GBM
FH

Angie (Verified Customer) (07-24-2024)

WB result of VEGFA antibody (used at 1:5000) incubated at room temperature for 1.5 hours. Two stronger bands between 35-50 kDa were observed.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: A549
VEGFA Antibody Western Blot validation (1:5000 dilution) in A549 (Cat no:19003-1-AP)
FH

Alexandru (Verified Customer) (11-21-2023)

Great antibody with clear and specific signal, would buy again!

  • Applications: Western Blot
  • Cell Tissue Type: Mouse Ventricle
FH

Fiona (Verified Customer) (07-16-2019)

Good quality antibody and good value for money. Would purchase again.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: ARPE-19
VEGFA Antibody Western Blot, validation (1:500 dilution) in ARPE-19 (Cat no:19003-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...