• Featured Product
  • KD/KO Validated

VEGFA Monoclonal antibody

VEGFA Monoclonal Antibody for WB, IHC, IHC-Autostainer, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 66828-1-Ig
Clone No.2E2H9

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (5)

Applications

WB, IHC, IHC-Autostainer, IF/ICC, IF-P, FC (Intra), ELISA

VEGF, 2E2H9, L-VEGF, N-VEGF, Vascular Endothelial Growth Factor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, HUVEC cells, NCI-H1299 cells, A431 cells, SH-SY5Y cells, HuH-7 cells, T-47D cells, MDA-MB-231 cells
Positive IHC-Autostainer detected inhuman Lung Cancer tissue
Positive IHC detected inhuman lung cancer tissue, human colon cancer tissue, human liver cancer tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman endometrial cancer tissue, human lung cancer tissue
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:50-1:500
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66828-1-Ig targets VEGFA in WB, IHC, IHC-Autostainer, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat, pig, rabbit, zebrafish, goat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13500

Product name: Recombinant human VEGFA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-302 aa of BC065522

Sequence: AAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Predict reactive species
Full Name vascular endothelial growth factor A
Calculated Molecular Weight 412 aa, 46 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC065522
Gene Symbol VEGFA
Gene ID (NCBI) 7422
RRIDAB_2882171
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15692
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VEGFA, also named as VEGF or VPF, belongs to the PDGF/VEGF growth factor family. It is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. VEGFA induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Defects in VEGFA are associated with microvascular complications of diabetes type 1 (MVCD1). VEGFA has 17 isoforms with MW from 16 to 45 kDa. Some isoforms have homodimer forms (e.g.; VEGFA189 38kDa or VEFGA110 34 kDa). VEGF-A exists in at least seven homodimeric isoforms. The monomers consist of 121, 145, 148, 165, 183, 189, or 206 amino acids (PMID:15602010 ). This antibody can recognize all VEGFA isoforms.

Protocols

Product Specific Protocols
FC protocol for VEGFA antibody 66828-1-IgDownload protocol
IF protocol for VEGFA antibody 66828-1-IgDownload protocol
IHC protocol for VEGFA antibody 66828-1-IgDownload protocol
WB protocol for VEGFA antibody 66828-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Signal Transduct Target Ther

Aberrant Notch-signaling promotes tumor angiogenesis in esophageal squamous-cell carcinoma

Authors - Cainan Li

ACS Nano

Inhalation of Mesenchymal-Stem-Cell-Derived Nanovesicles Delivering Catalase Enhances the Treatment for Acute Lung Injury

Authors - Linna Zhang
WB

Adv Sci (Weinh)

Spatiotemporal Characterization of Human Early Intervertebral Disc Formation at Single-Cell Resolution

Authors - Taifeng Zhou
rat,humanWB,IHC,IF

J Nanobiotechnology

Injectable HAMA-CPC hydrogels loaded with high-yield 3D bioprinted adipose-derived stem cell small extracellular vesicles for increased bone repair

Authors - Wenbin Xu
pigWB

Redox Biol

Nox2 impairs VEGF-A-induced angiogenesis in placenta via mitochondrial ROS-STAT3 pathway.

Authors - Chengjun Hu
  • KD Validated
humanWB

J Transl Med

KPNA2 promotes angiogenesis by regulating STAT3 phosphorylation

Authors - Yujie Jia

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Grace (Verified Customer) (01-31-2025)

Works great for immunofluorescence (1:200), but I've had issues with western blotting. Only very faint bands show up in samples I know have high protein levels.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:200
Loading...
||
New chat

Able

正在加载,请稍候...