VPS18 Monoclonal antibody

• 

  WB analysis using 67590-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67590-1-Ig (VPS18 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67590-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67590-1-Ig (VPS18 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67590-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67590-1-Ig (VPS18 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 67590-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using VPS18 antibody (67590-1-Ig, Clone: 2E10G11 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

VPS18 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67590-1-Ig

Clone No.2E10G11

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

hVPS18, KIAA1475, PEP3, VPS18

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67590-1-Ig targets VPS18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Rat samples.

• Tested Reactivity: Human, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29954

  Product name: Recombinant human VPS18 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 226-355 aa of BC001513

  Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL

• Full Name: vacuolar protein sorting 18 homolog (S. cerevisiae)
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC001513
• Gene Symbol: VPS18
• Gene ID (NCBI): 57617
• RRID: AB_2882798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P253
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.