Tested Applications
| Positive WB detected in | U-937 cells, SMMC-7721 cells, HepG2 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IF | See 1 publications below |
Product Information
14272-1-AP targets VPS4A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5592 Product name: Recombinant human VPS4A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 86-437 aa of BC047932 Sequence: KENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES Predict reactive species |
| Full Name | vacuolar protein sorting 4 homolog A (S. cerevisiae) |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 48-55 kDa |
| GenBank Accession Number | BC047932 |
| Gene Symbol | VPS4A |
| Gene ID (NCBI) | 27183 |
| RRID | AB_2878039 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UN37 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Vacuolar Protein Sorting 4A (VPS4A) is one of two human homologs of the yeast protein Vps4 and member of the AAA protein family (ATPases associated with diverse cellular activities).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for VPS4A antibody 14272-1-AP | Download protocol |
| WB protocol for VPS4A antibody 14272-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Life Sci Sex-specific molecular hallmarks point to increased atherogenesis susceptibility in male senescence-accelerated mice | ||
Parasitol Res Microautophagy upregulation in cutaneous lymph nodes of dogs naturally infected by Leishmania infantum. | ||
Theranostics Endosome-microautophagy targeting chimera (eMIATAC) for targeted proteins degradation and enhance CAR-T cell anti-tumor therapy | ||
J Pharmacol Exp Ther DBeQ derivative targets vacuolar protein sorting 4 functions in cancer cells and suppresses tumor growth in mice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Nuo (Verified Customer) (11-07-2024) | This antibody can detect endogenous VPS4A with a MW of around 50 kD.
|















