VPS53 Monoclonal antibody, PBS Only

• 

  WB analysis using 67610-1-Ig (same clone as 67610-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67610-1-Ig (VPS53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67610-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67610-1-Ig (same clone as 67610-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67610-1-Ig (VPS53 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67610-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67610-1-Ig (same clone as 67610-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67610-1-Ig (VPS53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67610-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67610-1-Ig (same clone as 67610-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67610-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67610-1-Ig (same clone as 67610-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67610-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67610-1-Ig (same clone as 67610-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67610-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67610-1-Ig (same clone as 67610-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67610-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 67610-1-Ig (same clone as 67610-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using 67610-1-Ig (VPS53 antibody), at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67610-1-PBS in a different storage buffer formulation.

VPS53 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67610-1-PBS

Clone No.2B12C3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

2B12C3, PP13624, Vacuolar protein sorting-associated protein 53 homolog

---

Product Information

67610-1-PBS targets VPS53 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29875

  Product name: Recombinant human VPS53 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-128 aa of BC029560

  Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL

• Full Name: vacuolar protein sorting 53 homolog (S. cerevisiae)
• Calculated Molecular Weight: 832 aa, 94 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC029560
• Gene Symbol: VPS53
• Gene ID (NCBI): 55275
• RRID: AB_2882816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5VIR6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins.