Product Information
67610-1-PBS targets VPS53 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29875 Product name: Recombinant human VPS53 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-128 aa of BC029560 Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL Predict reactive species |
Full Name | vacuolar protein sorting 53 homolog (S. cerevisiae) |
Calculated Molecular Weight | 832 aa, 94 kDa |
Observed Molecular Weight | 94 kDa |
GenBank Accession Number | BC029560 |
Gene Symbol | VPS53 |
Gene ID (NCBI) | 55275 |
RRID | AB_2882816 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q5VIR6 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
VPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins.