Tested Applications
Positive WB detected in | U2OS cells, HeLa cells, NIH/3T3 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, LNCaP cells, 4T1 cells |
Positive IHC detected in | human liver tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:150-1:600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67610-1-Ig targets VPS53 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29875 Product name: Recombinant human VPS53 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-128 aa of BC029560 Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL Predict reactive species |
Full Name | vacuolar protein sorting 53 homolog (S. cerevisiae) |
Calculated Molecular Weight | 832 aa, 94 kDa |
Observed Molecular Weight | 94 kDa |
GenBank Accession Number | BC029560 |
Gene Symbol | VPS53 |
Gene ID (NCBI) | 55275 |
RRID | AB_2882816 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q5VIR6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for VPS53 antibody 67610-1-Ig | Download protocol |
IHC protocol for VPS53 antibody 67610-1-Ig | Download protocol |
IF protocol for VPS53 antibody 67610-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |