VPS53 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• VPS53 Monoclonal antibody (67610-1-Ig)

• Featured Product
• KD/KO Validated

VPS53 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67610-1-Ig Copied!

Clone No. 2B12C3

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2B12C3, PP13624, Vacuolar protein sorting-associated protein 53 homolog

• 

  WB analysis using 67610-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67610-1-Ig (VPS53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 67610-1-Ig

  WB result of VPS53 antibody (67610-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-VPS53 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67610-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67610-1-Ig (VPS53 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67610-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67610-1-Ig (VPS53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 67610-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 67610-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 67610-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 67610-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 67610-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using 67610-1-Ig (VPS53 antibody), at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for VPS53 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U2OS cells, HEK-293 cells, HeLa cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells, LNCaP cells
• Positive IHC detected in: human liver tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67610-1-Ig targets VPS53 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29875

  Product name: Recombinant human VPS53 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-128 aa of BC029560

  Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL

• Full Name: vacuolar protein sorting 53 homolog (S. cerevisiae)
• Calculated Molecular Weight: 832 aa, 94 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC029560
• Gene Symbol: VPS53
• Gene ID (NCBI): 55275
• RRID: AB_2882816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q5VIR6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins.

Publications

What published studies show

The VPS53 Monoclonal antibody (2B12C3), catalog number 67610-1-Ig, has a total of 1 citation. It was cited in Communications Biology (Impact Factor: 5.8) in a 2025 study by Véronique Gaudreault et al. The research field involves RAB GTPase signaling, endosomal trafficking, and the EARP complex, with the antibody applied in Western Blot (WB) for human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Commun Biol; A proximity map of RAB GTPases delineates roles for RAB14 in EARP complex and UHRF1BP1 endosomal recruitments.; Authors - Véronique Gaudreault