VPS53 Monoclonal antibody

• 

  WB analysis using 67610-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67610-1-Ig (VPS53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control.

• 

  WB analysis of HEK-293 using 67610-1-Ig

  WB result of VPS53 antibody (67610-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-VPS53 transfected HEK-293 cells.

• 

  WB analysis using 67610-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67610-1-Ig (VPS53 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67610-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67610-1-Ig (VPS53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 67610-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 67610-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 67610-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 67610-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67610-1-Ig (VPS53 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 67610-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using 67610-1-Ig (VPS53 antibody), at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

VPS53 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67610-1-Ig

Clone No.2B12C3

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2B12C3, PP13624, Vacuolar protein sorting-associated protein 53 homolog

---

Tested Applications

• Positive WB detected in: U2OS cells, HEK-293 cells, HeLa cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells, LNCaP cells
• Positive IHC detected in: human liver tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67610-1-Ig targets VPS53 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29875

  Product name: Recombinant human VPS53 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-128 aa of BC029560

  Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL

• Full Name: vacuolar protein sorting 53 homolog (S. cerevisiae)
• Calculated Molecular Weight: 832 aa, 94 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC029560
• Gene Symbol: VPS53
• Gene ID (NCBI): 55275
• RRID: AB_2882816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q5VIR6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

VPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Commun Biol; A proximity map of RAB GTPases delineates roles for RAB14 in EARP complex and UHRF1BP1 endosomal recruitments.; Authors - Véronique Gaudreault