Tested Applications
Positive WB detected in | HeLa cells, RAW 264.7 cells |
Positive IHC detected in | human heart tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 3 publications below |
Product Information
28820-1-AP targets WIPI2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.
Tested Reactivity | Human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30505 Product name: Recombinant human WIPI2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 368-454 aa of BC004116 Sequence: ALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD Predict reactive species |
Full Name | WD repeat domain, phosphoinositide interacting 2 |
Calculated Molecular Weight | 49 kDa |
Observed Molecular Weight | 49 kDa |
GenBank Accession Number | BC004116 |
Gene Symbol | WIPI2 |
Gene ID (NCBI) | 26100 |
RRID | AB_2881218 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y4P8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WIPI2, the mammalian homologue of the yeast ATG18 gene, plays a key role in autophagy. It binds the omegasome, a phosphatidylinositol 3-phosphate (PI3P) rich domain of the endoplasmic reticulum from which the mature autophagosome develops. Western blotting detected a 49 kDa WIPI2 band.(PMID: 30968111, PMID: 30403914)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for WIPI2 antibody 28820-1-AP | Download protocol |
IHC protocol for WIPI2 antibody 28820-1-AP | Download protocol |
IF protocol for WIPI2 antibody 28820-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Int J Mol Sci COPI Vesicle Disruption Inhibits Mineralization via mTORC1-Mediated Autophagy | ||
Adv Sci (Weinh) SEC31a-ATG9a Interaction Mediates the Recruitment of COPII Vesicles for Autophagosome Formation | ||
Cell Death Differ Vps34 sustains Treg cell survival and function via regulating intracellular redox homeostasis | ||
Autophagy Regulation of N-Degron Recognin-Mediated Autophagy by the sars-cov-2 plpro ubiquitin deconjugase |