WIPI2 Polyclonal antibody

• 

  WB analysis using 28820-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28820-1-AP (WIPI2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 28820-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 28820-1-AP (WIPI2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 28820-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 28820-1-AP (WIPI2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 28820-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28820-1-AP (WIPI2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 28820-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28820-1-AP (WIPI2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 28820-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using WIPI2 antibody (28820-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

WIPI2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28820-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ATG18B, Atg21, CGI 50, CGI50, CGI-50

---

Tested Applications

• Positive WB detected in: HeLa cells, RAW 264.7 cells
• Positive IHC detected in: human heart tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 3 publications below

Product Information

28820-1-AP targets WIPI2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30505

  Product name: Recombinant human WIPI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 368-454 aa of BC004116

  Sequence: ALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD

• Full Name: WD repeat domain, phosphoinositide interacting 2
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC004116
• Gene Symbol: WIPI2
• Gene ID (NCBI): 26100
• RRID: AB_2881218
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4P8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WIPI2, the mammalian homologue of the yeast ATG18 gene, plays a key role in autophagy. It binds the omegasome, a phosphatidylinositol 3-phosphate (PI3P) rich domain of the endoplasmic reticulum from which the mature autophagosome develops. Western blotting detected a 49 kDa WIPI2 band.(PMID: 30968111, PMID: 30403914)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Int J Mol Sci; COPI Vesicle Disruption Inhibits Mineralization via mTORC1-Mediated Autophagy; Authors - Jiaming Nie
mouse	WB	Autophagy; TBC1D4 antagonizes RAB2A-mediated autophagic and endocytic pathways; Authors - Rui Tian
rat	IF	Adv Sci (Weinh); SEC31a-ATG9a Interaction Mediates the Recruitment of COPII Vesicles for Autophagosome Formation; Authors - Jiaming Nie
	WB	Cell Death Differ; Vps34 sustains Treg cell survival and function via regulating intracellular redox homeostasis; Authors - Peiran Feng
	IF	Autophagy; Regulation of N-Degron Recognin-Mediated Autophagy by the sars-cov-2 plpro ubiquitin deconjugase; Authors - Carlos Ayala Torres
human	WB	Nat Commun; Molecular bases of the interactions of ATG16L1 with FIP200 and ATG8 family proteins; Authors - Xinyu Gong