WNT2 Polyclonal antibody, PBS Only

• 

  WB analysis using 27214-1-AP (same clone as 27214-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27214-1-AP (WNT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27214-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27214-1-AP (same clone as 27214-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27214-1-AP (WNT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27214-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27214-1-AP (same clone as 27214-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27214-1-AP (WNT2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27214-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 27214-1-AP (same clone as 27214-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 27214-1-AP (WNT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27214-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27214-1-AP (same clone as 27214-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27214-1-AP (WNT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27214-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 27214-1-AP (same clone as 27214-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using WNT2 antibody (27214-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27214-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Jurkat using 27214-1-AP (same clone as 27214-1-PBS)

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human WNT2 (27214-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP, Clone: ) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 27214-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

WNT2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 27214-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

Int 1 like protein 1, Int 1 related protein, INT1L1, Int-1-like protein 1, Int-1-related protein

---

Product Information

27214-1-PBS targets WNT2 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25845

  Product name: Recombinant human WNT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 231-270 aa of BC029854

  Sequence: GDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVY

• Full Name: wingless-type MMTV integration site family member 2
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 34-40 kDa
• GenBank Accession Number: BC029854
• Gene Symbol: WNT2
• Gene ID (NCBI): 7472
• RRID: AB_2880804
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09544
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Wnt2 is a secreted glycoprotein that is one of the canonical Wnt ligands. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt2 is known to directly regulate β-catenin activity, the key player in proliferation and inflammation. Recently, studies have demonstrated that Wnt2 is overexpressed in various human cancers, including esophageal, gastric, colorectal, breast, lung, cervical, and malignant glioma.