• Featured Product
  • KD/KO Validated

WNT2 Polyclonal antibody, PBS Only

WNT2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 27214-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Int 1 like protein 1, Int 1 related protein, INT1L1, Int-1-like protein 1, Int-1-related protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

27214-1-PBS targets WNT2 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25845

Product name: Recombinant human WNT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 231-270 aa of BC029854

Sequence: GDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVY

Predict reactive species
Full Name wingless-type MMTV integration site family member 2
Calculated Molecular Weight 40 kDa
Observed Molecular Weight34-40 kDa
GenBank Accession NumberBC029854
Gene Symbol WNT2
Gene ID (NCBI) 7472
RRIDAB_2880804
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09544
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Wnt2 is a secreted glycoprotein that is one of the canonical Wnt ligands. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt2 is known to directly regulate β-catenin activity, the key player in proliferation and inflammation. Recently, studies have demonstrated that Wnt2 is overexpressed in various human cancers, including esophageal, gastric, colorectal, breast, lung, cervical, and malignant glioma.

Loading...
||
New chat Able
正在加载,请稍候...