WT1 Polyclonal antibody

WT1 Polyclonal Antibody for WB, ELISA
Cat No. 23235-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

GUD, WAGR, Wilms tumor 1, Wilms tumor protein, WIT 2, WT1, WT33

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23235-1-AP targets WT1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19541

Product name: Recombinant human WT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-302 aa of BC032861

Sequence: MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRMHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL

Predict reactive species
Full Name Wilms tumor 1
Calculated Molecular Weight 449 aa, 49 kDa, 57 kDa
GenBank Accession NumberBC032861
Gene Symbol WT1
Gene ID (NCBI) 7490
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19544
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The WT1 gene encodes a zinc finger DNA-binding protein that acts as a transcriptional activator or repressor depending on the cellular or chromosomal context, and it is required for normal formation of the genitourinary system and mesothelial tissues. WT1 inhibits apoptosis through p53 and Bcl-2 and also inhibits the differentiation of leukemic cells. Function of WT1 may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA.

Loading...
||
New chat Able
正在加载,请稍候...