Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human kidney tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24750-1-AP targets WWC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20479 Product name: Recombinant human WWC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1080-1165 aa of BC017957 Sequence: QSRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQRLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPR Predict reactive species |
| Full Name | WW and C2 domain containing 2 |
| Calculated Molecular Weight | 1192 aa, 134 kDa |
| Observed Molecular Weight | 150 kDa |
| GenBank Accession Number | BC017957 |
| Gene Symbol | WWC2 |
| Gene ID (NCBI) | 80014 |
| RRID | AB_2879704 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6AWC2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WWC2 alson named as BOMB or WW and C2 domain containing 2 is 1192 amino acid protein, which contains 1 C2 domain and 2 WW domains. WWC2 localizes in cytoplasm and belongs to the WWC family. , WWC2 exists as seven alternatively spliced isoforms and is encoded by a gene located on human chromosome 4q35.1. WWC2 may be expressed in liver, brain, prostate and kidney. The function of WWC2 is still non-known and need to be further studied.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for WWC2 antibody 24750-1-AP | Download protocol |
| IHC protocol for WWC2 antibody 24750-1-AP | Download protocol |
| IP protocol for WWC2 antibody 24750-1-AP | Download protocol |
| WB protocol for WWC2 antibody 24750-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TEAD1 antibody (Cat# 24750-1-AP) has 3 total citations. These appear in Nucleic Acids Research (IF 15), Cancer Immunology Research (IF 7.9), and Cell Signaling (IF 4.7). The associated research fields include transcriptional regulation of cell proliferation, Hippo/YAP signaling in the tumor microenvironment of colorectal cancer, and pan-cancer analysis of WWC family genes with functional validation in lung cancer. All three studies applied the antibody via Western blot.
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res TEAD1 regulates cell proliferation through a pocket-independent transcription repression mechanism | ||
Cancer Immunol Res CLK1 Promotes Myeloid-Derived Suppressor Cell Trafficking and Reprograms the Tumor Microenvironment by Activating Hippo/YAP Signaling in Colorectal Cancer.
| ||
Cell Signal An integrative pan-cancer analysis of WWC family genes and functional validation in lung cancer |
