WWC2 Polyclonal antibody

• 

  WB analysis using 24750-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24750-1-AP (WWC2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 24750-1-AP

  IP result of anti-WWC2 (IP:24750-1-AP, 4ug; Detection:24750-1-AP 1:500) with HEK-293 cells lysate 1360 ug.

• 

  IHC staining of human kidney using 24750-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24750-1-AP (WWC2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 24750-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24750-1-AP (WWC2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 24750-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24750-1-AP (WWC2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 24750-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24750-1-AP (WWC2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HEK-293 using 24750-1-AP

  Immunofluorescent analysis of HEK-293 cells using 24750-1-AP (WWC2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

WWC2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 24750-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

BH 3 only member B, BOMB, Protein WWC2, WW and C2 domain containing 2, WW domain containing protein 2, WWC2

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human kidney tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

24750-1-AP targets WWC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20479

  Product name: Recombinant human WWC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1080-1165 aa of BC017957

  Sequence: QSRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQRLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPR

• Full Name: WW and C2 domain containing 2
• Calculated Molecular Weight: 1192 aa, 134 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC017957
• Gene Symbol: WWC2
• Gene ID (NCBI): 80014
• RRID: AB_2879704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6AWC2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WWC2 alson named as BOMB or WW and C2 domain containing 2 is 1192 amino acid protein, which contains 1 C2 domain and 2 WW domains. WWC2 localizes in cytoplasm and belongs to the WWC family. , WWC2 exists as seven alternatively spliced isoforms and is encoded by a gene located on human chromosome 4q35.1. WWC2 may be expressed in liver, brain, prostate and kidney. The function of WWC2 is still non-known and need to be further studied.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nucleic Acids Res; TEAD1 regulates cell proliferation through a pocket-independent transcription repression mechanism; Authors - Feng Li
human	WB	Cell Signal; An integrative pan-cancer analysis of WWC family genes and functional validation in lung cancer; Authors - Hongmei Huang