Tested Applications
| Positive WB detected in | rat spleen tissue, mouse spleen tissue |
| Positive IHC detected in | human breast cancer tissue, human colon cancer tissue, human liver cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 46 publications below |
| IHC | See 7 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
25997-1-AP targets XBP1U specific in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21714 Product name: Recombinant human XBP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 167-261 aa of BC000938 Sequence: LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN Predict reactive species |
| Full Name | X-box binding protein 1 |
| Calculated Molecular Weight | 261 aa, 29 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC000938 |
| Gene Symbol | XBP1 |
| Gene ID (NCBI) | 7494 |
| RRID | AB_2880326 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17861 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
X-box-binding protein 1 (XBP1), also named as TREB5, is a 261 amino acid protein, which contains one bZIP domain and belongs to the bZIP family. XBP1 localizes in the nucleus and as a transcription factor is essential for hepatocyte growth, the differentiation of plasma cells, the immunoglobulin secretion, and the unfolded protein response. XBP1 has an association with major affective disorder. The molecular weight of protein generated from the spliced XBP1 mRNA is 54 kDa and protein generated from unspliced Xbp1 mRNA is 33 kDa. This antibody 25997-1-AP specially recognizes isoform XBP-1U.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for XBP1U specific antibody 25997-1-AP | Download protocol |
| IHC protocol for XBP1U specific antibody 25997-1-AP | Download protocol |
| WB protocol for XBP1U specific antibody 25997-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Extracell Vesicles A multi-omics approach identifies pancreatic cancer cell extracellular vesicles as mediators of the unfolded protein response in normal pancreatic epithelial cells. | ||
Hepatology Farnesoid X receptor signaling activates the hepatic X-box binding protein 1 pathway in vitro and in mice. | ||
Sci Adv Identification of XBP1-u as a novel regulator of the MDM2/p53 axis using an shRNA library. | ||
Acta Pharm Sin B The substitution of SERCA2 redox cysteine 674 promotes pulmonary vascular remodeling by activating IRE1α/XBP1s pathway. | ||
Autophagy Inhibition of USP14 influences alphaherpesvirus proliferation by degrading viral VP16 protein via ER stress-triggered selective autophagy. | ||
Oncogene Knockdown of TM9SF4 boosts ER stress to trigger cell death of chemoresistant breast cancer cells. |























