XPA Polyclonal antibody, PBS Only

• 

  WB analysis of L02 using 16462-1-AP (same clone as 16462-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 16462-1-AP (XPA Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 16462-1-AP (same clone as 16462-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 16462-1-AP (XPA Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16462-1-AP (same clone as 16462-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16462-1-AP (XPA Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 16462-1-AP (same clone as 16462-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 16462-1-AP (XPA Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 16462-1-AP (same clone as 16462-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16462-1-AP (XPA Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16462-1-AP (same clone as 16462-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16462-1-AP (XPA Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16462-1-AP (same clone as 16462-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16462-1-AP (XPA Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 16462-1-AP (same clone as 16462-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 16462-1-AP (XPA Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  IP experiment of L02 using 16462-1-AP (same clone as 16462-1-PBS)

  IP result of anti-XPA (IP:16462-1-AP, 4ug; Detection:16462-1-AP 1:300) with L02 cells lysate 3000 ug. This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16462-1-AP (same clone as 16462-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using XPA antibody (16462-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 16462-1-AP (same clone as 16462-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human XPA (16462-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 16462-1-PBS in a different storage buffer formulation.

XPA Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 16462-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

DNA repair protein complementing XP-A cells, Xeroderma pigmentosum group A-complementing protein, XP1, XPAC

---

Product Information

16462-1-PBS targets XPA in WB, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9536

  Product name: Recombinant human XPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-273 aa of BC014965

  Sequence: MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM

• Full Name: xeroderma pigmentosum, complementation group A
• Calculated Molecular Weight: 374aa,42 kDa; 273aa,31 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC014965
• Gene Symbol: XPA
• Gene ID (NCBI): 7507
• RRID: AB_2878261
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23025
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

XPA, also named as DNA repair protein complementing XP-A cells, is a 272 amino acid protein, which belongs to the XPA family. XPA is expressed in various cell lines and in skin fibroblasts. XPA is involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. XPA is required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation. The calculated molecular weight of XPA is 31 kDa, but modified XPA protein is about 40 kDa (PMID: 17848622).