XRN2 Monoclonal antibody

• 

  WB analysis using 66852-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66852-1-Ig (XRN2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66852-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66852-1-Ig (XRN2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 66852-1-Ig

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 66852-1-Ig (XRN2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 66852-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66852-1-Ig (XRN2 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66852-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66852-1-Ig (XRN2 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 66852-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using XRN2 antibody (66852-1-Ig, Clone: 2C3E3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

• 

  FC experiment of HepG2 using 66852-1-Ig

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human XRN2 (66852-1-Ig, Clone:2C3E3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

XRN2 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66852-1-Ig

Clone No.2C3E3

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

2C3E3, 5 3 exoribonuclease 2, 5' 3' exoribonuclease 2, 5'-3' exoribonuclease 2, DHM1 like protein

---

Tested Applications

• Positive WB detected in: HT-29 cells, HEK-293 cells, COLO 320 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

66852-1-Ig targets XRN2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27927

  Product name: Recombinant human XRN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 651-950 aa of BC006417

  Sequence: PFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVTYQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN

• Full Name: 5'-3' exoribonuclease 2
• Calculated Molecular Weight: 104 kDa
• Observed Molecular Weight: 109 kDa
• GenBank Accession Number: BC006417
• Gene Symbol: XRN2
• Gene ID (NCBI): 22803
• RRID: AB_2882192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H0D6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XRN2 is one exonuclease that degrades the Pol II associated product of poly(A) site cleavage, which is crucial for Pol II termination. During transcription termination, XRN2 cleavages at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Am J Physiol Cell Physiol; Hydrogen sulfide rescues high glucose-induced migration dysfunction in HUVECs by upregulating miR-126-3p.; Authors - Wen-Long Xue
human	WB	Cancer Res; NAT10 drives cisplatin chemoresistance by enhancing ac4C-associated DNA repair in bladder cancer; Authors - Ruihui Xie
human	WB,IF	Cell Rep; Transketolase attenuates the chemotherapy sensitivity of glioma cells by modulating R-loop formation; Authors - Minjie Fu