CoraLite® Plus 488-conjugated XRN2 Monoclonal antibody

XRN2 Monoclonal Antibody for FC (Intra)
Cat No. CL488-66852
Clone No.2C3E3

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

FC (Intra)

DHM1-like protein, DHM1 like protein, 5'-3' exoribonuclease 2, 5' 3' exoribonuclease 2, 5 3 exoribonuclease 2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66852 targets XRN2 in FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27927

Product name: Recombinant human XRN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 651-950 aa of BC006417

Sequence: PFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVTYQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN

Predict reactive species
Full Name 5'-3' exoribonuclease 2
Calculated Molecular Weight 104 kDa
Observed Molecular Weight 109 kDa
GenBank Accession NumberBC006417
Gene Symbol XRN2
Gene ID (NCBI) 22803
RRIDAB_3084279
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H0D6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

XRN2 is one exonuclease that degrades the Pol II associated product of poly(A) site cleavage, which is crucial for Pol II termination. During transcription termination, XRN2 cleavages at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 XRN2 antibody CL488-66852Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...