XRN2 Monoclonal antibody, PBS Only

• 

  WB analysis using 66852-1-Ig (same clone as 66852-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66852-1-Ig (XRN2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66852-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66852-1-Ig (same clone as 66852-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66852-1-Ig (XRN2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66852-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 66852-1-Ig (same clone as 66852-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 66852-1-Ig (XRN2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66852-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66852-1-Ig (same clone as 66852-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66852-1-Ig (XRN2 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66852-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66852-1-Ig (same clone as 66852-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66852-1-Ig (XRN2 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66852-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 66852-1-Ig (same clone as 66852-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using XRN2 antibody (66852-1-Ig, Clone: 2C3E3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66852-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66852-1-Ig (same clone as 66852-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human XRN2 (66852-1-Ig, Clone:2C3E3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 66852-1-PBS in a different storage buffer formulation.

XRN2 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66852-1-PBS

Clone No.2C3E3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

2C3E3, 5 3 exoribonuclease 2, 5' 3' exoribonuclease 2, 5'-3' exoribonuclease 2, DHM1 like protein

---

Product Information

66852-1-PBS targets XRN2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27927

  Product name: Recombinant human XRN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 651-950 aa of BC006417

  Sequence: PFVDERRLRAALEEVYPDLTPEETRRNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDPQFAEDYIFKAVMLPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRGSGTGIYSNAAPPPVTYQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQNAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN

• Full Name: 5'-3' exoribonuclease 2
• Calculated Molecular Weight: 104 kDa
• Observed Molecular Weight: 109 kDa
• GenBank Accession Number: BC006417
• Gene Symbol: XRN2
• Gene ID (NCBI): 22803
• RRID: AB_2882192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H0D6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

XRN2 is one exonuclease that degrades the Pol II associated product of poly(A) site cleavage, which is crucial for Pol II termination. During transcription termination, XRN2 cleavages at the polyadenylation site liberates a 5' fragment which is subsequently processed to form the mature mRNA and a 3' fragment which remains attached to the elongating polymerase. The processive degradation of this 3' fragment by this protein may promote termination of transcription.