• Featured Product
  • KD/KO Validated

YAP1 Polyclonal antibody

YAP1 antibodies are used to detect Yes-associated protein 1, a critical effector in the Hippo pathway, in studies of cell proliferation, organ size regulation, and cancer. Proteintech has an extensive range of YAP1 antibodies validated for WB, IHC, IF/ICC, IF-P, FC (Intra) IP, ELISA and more.

Cat No. 13584-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, ELISA

65 kDa Yes associated protein, Protein yorkie homolog, Transcriptional coactivator YAP1, YAP, yes associated protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, MCF-7 cells, HeLa cells, BGC-823 cells, HepG2 cells, SGC-7901 cells, mouse liver tissue, rat liver tissue, L02 cells
Positive IP detected inNIH/3T3 cells
Positive IHC detected inhuman liver cancer tissue, human ovary tumor tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman lung cancer tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13584-1-AP targets YAP1 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4510

Product name: Recombinant human YAP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 155-504 aa of BC038235

Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Predict reactive species
Full Name Yes-associated protein 1, 65kDa
Calculated Molecular Weight 504 aa, 54 kDa
Observed Molecular Weight65-75 kDa
GenBank Accession NumberBC038235
Gene Symbol YAP1
Gene ID (NCBI) 10413
RRIDAB_2218915
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46937
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Yes-associated protein 1 (YAP1) is a transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).Increased expression seen in some liver and prostate cancers (PMID: 31613226, 32488048, 33520338). Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).It is actived by phosphorylation and degradated by ubiquitination (PMID: 20048001).This antibody is a rabbit polyclonal antibody. The calcualted molecular weight of YAP1 is 54 kDa, but routinely observed at 65-75 kDa by Western Blot (PMID: 28230103, 33264286, 36255405).

Protocols

Product Specific Protocols
IF protocol for YAP1 antibody 13584-1-APDownload protocol
IHC protocol for YAP1 antibody 13584-1-APDownload protocol
IP protocol for YAP1 antibody 13584-1-APDownload protocol
WB protocol for YAP1 antibody 13584-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IF

Nature

Fat1 deletion promotes hybrid EMT state, tumour stemness and metastasis.

Authors - Ievgenia Pastushenko
mouseIF

Nature

Mechanisms of stretch-mediated skin expansion at single-cell resolution.

Authors - Mariaceleste Aragona
mouseWB

Nature

YAP/TAZ activity in stromal cells prevents ageing by controlling cGAS-STING.

Authors - Hanna Lucie Sladitschek-Martens
mouseIHC

Nature

Divergent transcriptional regulation of astrocyte reactivity across disorders.

Authors - Joshua E Burda
humanIF

Nature

The SWI/SNF complex is a mechanoregulated inhibitor of YAP and TAZ.

Authors - Lei Chang
mouseIF

Nat Mater

Reprogramming normal cells into tumour precursors requires ECM stiffness and oncogene-mediated changes of cell mechanical properties.

Authors - Tito Panciera

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Mounika (Verified Customer) (12-25-2025)

This antibody played very critical role in our project Hippo signaling pathway, worked very excellently, enjoyed working with it at ease!

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, ChIP
  • Primary Antibody Dilution: 1:1000
FH

Ayse (Verified Customer) (10-08-2025)

Works well.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:200
FH

Udesh (Verified Customer) (06-17-2025)

Worked well for IF and WB

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:1000 for WB and 1:2000 for IF
  • Cell Tissue Type: MSCs
FH

Kis (Verified Customer) (02-21-2025)

This antibody performs well for both Western blot (WB) and immunohistochemistry (IHC) in human and mouse models.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1.1000
FH

Kazuaki (Verified Customer) (01-28-2025)

Works well

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: Mouse myoblast C2C12 cell line
FH

Siddharth (Verified Customer) (08-04-2023)

Great for IF. Detects both Cytoplasmic and Nuclear YAP1.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: hMSC cell line
YAP1 Antibody Immunofluorescence validation (1:100 dilution) in hMSC cell line (Cat no:13584-1-AP)
FH

Chiara (Verified Customer) (09-15-2022)

In RH4 cells I observe by Western blot 4 bands; two bands around 70 KDa correspond to YAP, while a single band around 55 KDa corresponds to TAZ protein as proved by a RNA interference experiment.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: RH4 Rhabdomyosarcoma cell line
YAP1 Antibody Western Blot validation (1:1000 dilution) in RH4 Rhabdomyosarcoma cell line (Cat no:13584-1-AP)
FH

María (Verified Customer) (02-08-2022)

Works for WB (1:1000).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Arianna (Verified Customer) (03-01-2019)

Genetically validated on YAP-null liver sections.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Liver tissue
FH

Joshua (Verified Customer) (12-20-2018)

Cells were fixed in 4% paraformaldehyde and stained overnight at 4C. Cells were counterstained with DAPI and phalloidin. Stain was mix of nuclear, cytosolic, and junctional.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: MDCK Canine Kidney Epithelial
YAP1 Antibody Immunofluorescence, validation (1:500 dilution) in MDCK Canine Kidney Epithelial (Cat no:13584-1-AP)
FH

Joshua (Verified Customer) (12-20-2018)

Cells were fixed in 4% paraformaldehyde and stained overnight at 4C. Cells were counterstained with phalliodin and DAPI. Staining is mix of nuclear, junctional, and cytosolic.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: MDCK Canine Kidney Epithelial
YAP1 Antibody Immunofluorescence, validation (1:500 dilution) in MDCK Canine Kidney Epithelial (Cat no:13584-1-AP)
FH

Juan Pablo (Verified Customer) (11-29-2018)

CGN treated with Shh (1ug/ml) for 48hs to induced proliferation, I see a nice induction of YAP1I get a nice clean band

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Culture of Granule cell neurons from P7 rat pups
YAP1 Antibody Western Blot, validation (1:1000 dilution) in Culture of Granule cell neurons from P7 rat pups (Cat no:13584-1-AP)
FH

kk (Verified Customer) (11-21-2018)

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: human PANC1 cells
Loading...
||
New chat

Able

正在加载,请稍候...