• Featured Product
  • KD/KO Validated

YAP1 Polyclonal antibody, PBS Only

YAP1 antibodies are used to detect Yes-associated protein 1, a critical effector in the Hippo pathway, in studies of cell proliferation, organ size regulation, and cancer. Proteintech has an extensive range of YAP1 antibodies validated for WB, IHC, IF/ICC, IF-P, FC (Intra) IP, ELISA and more.

Cat No. 13584-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

65 kDa Yes associated protein, Protein yorkie homolog, Transcriptional coactivator YAP1, YAP, yes associated protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

13584-1-PBS targets YAP1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4510

Product name: Recombinant human YAP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 155-504 aa of BC038235

Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Predict reactive species
Full Name Yes-associated protein 1, 65kDa
Calculated Molecular Weight 504 aa, 54 kDa
Observed Molecular Weight65-75 kDa
GenBank Accession NumberBC038235
Gene Symbol YAP1
Gene ID (NCBI) 10413
RRIDAB_2218915
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46937
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Yes-associated protein 1 (YAP1) is a transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).Increased expression seen in some liver and prostate cancers (PMID: 31613226, 32488048, 33520338). Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).It is actived by phosphorylation and degradated by ubiquitination (PMID: 20048001).This antibody is a rabbit polyclonal antibody. The calcualted molecular weight of YAP1 is 54 kDa, but routinely observed at 65-75 kDa by Western Blot (PMID: 28230103, 33264286, 36255405).

Loading...
||
New chat

Able

正在加载,请稍候...