YIPF2 Polyclonal antibody

• 

  WB analysis of HepG2 using 20441-1-AP

  WB result of YIPF2 antibody (20441-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-YIPF2 transfected HepG2 cells.

• 

  WB analysis using 20441-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20441-1-AP (YIPF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 20441-1-AP

  IP result of anti-YIPF2 (IP:20441-1-AP, 4ug; Detection:20441-1-AP 1:500) with HepG2 cells lysate 1470 ug.

• Featured Product
• KD/KO Validated

YIPF2 Polyclonal Antibody for WB, IP, ELISA

Cat No. 20441-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

FinGER2, Protein YIPF2, Yip1 domain family, member 2, YIP1 family member 2

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20441-1-AP targets YIPF2 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14238

  Product name: Recombinant human YIPF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-86 aa of BC000056

  Sequence: MASADELTFHEFEEATNLLADTPDAATTSRSDQLTPQGHVAVAVGSGGSYGAEDEVEEESDKAALLQEQQQQQQPGFWTFSYYQSF

• Full Name: Yip1 domain family, member 2
• Calculated Molecular Weight: 316 aa, 35 kDa
• Observed Molecular Weight: 35~40 kDa
• GenBank Accession Number: BC000056
• Gene Symbol: YIPF2
• Gene ID (NCBI): 78992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWQ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YIPF2 is a member of YIP family whose name refers to the Ypt (yeast RAB GTPase)-interacting protein predicted to have five transmembrane segments with an N-terminal exposed to the cytoplasm and a short C-terminal exposed to the lumen of the secretory pathway. YIPF2 has been reported to mainly locate in the trans-Golgi network (TGN) co-localized with virous RAB proteins, suggesting that it is potentially involved in vesicle transport (PMID: 31189879). YIPF2 can serve as the GDF (GDI-displacement factor) of RAB5/RAB22A and intracellular binder of CD147 in HCC cells (PMID: 311898799).