Tested Applications
| Positive WB detected in | mouse colon tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30243-1-AP targets YIPF6 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32477 Product name: Recombinant human YIPF6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2-84 aa of BC012469 Sequence: AEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVGKKFMHVLYPRKSNT Predict reactive species |
| Full Name | Yip1 domain family, member 6 |
| Calculated Molecular Weight | 236 aa, 26 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC012469 |
| Gene Symbol | YIPF6 |
| Gene ID (NCBI) | 286451 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96EC8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YIPF6 encodes a Golgi- and ER-localized membrane protein that regulates vesicle trafficking and secretory pathway integrity through interaction with Rab GTPases. Highly expressed in intestinal epithelium and immune tissues, YIPF6 is essential for Paneth and goblet cell granule maturation and mucosal immune homeostasis. Loss of YIPF6 disrupts epithelial secretion and predisposes to inflammatory bowel-like disease, establishing it as a critical regulator of Golgi function and gut barrier defense.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for YIPF6 antibody 30243-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

