ZFYVE19 Polyclonal antibody

• 

  WB analysis of HeLa using 23163-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 23163-1-AP (ZFYVE19 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 23163-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 23163-1-AP (ZFYVE19 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 23163-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 23163-1-AP (ZFYVE19 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 23163-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 23163-1-AP (ZFYVE19 Antibody) at dilution of 1:50.

• 

  IHC staining of human liver cancer using 23163-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 23163-1-AP (ZFYVE19 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 23163-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart slide using 23163-1-AP (ZFYVE19 Antibody) at dilution of 1:50.

ZFYVE19 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23163-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Abscission/NoCut checkpoint regulator, ANCHR, MPFYVE, Zinc finger FYVE domain-containing protein 19

---

Tested Applications

• Positive WB detected in: HeLa cells, Raji cells
• Positive IHC detected in: human liver cancer tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23163-1-AP targets ZFYVE19 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19593

  Product name: Recombinant human ZFYVE19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 123-471 aa of BC015738

  Sequence: VCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEAALDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH

• Full Name: zinc finger, FYVE domain containing 19
• Calculated Molecular Weight: 471 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC015738
• Gene Symbol: ZFYVE19
• Gene ID (NCBI): 84936
• RRID: AB_2879219
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96K21
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZFYVE19, also known as ANCHR, is a poorly characterized human protein. Recent clinical studies have linked biallelic loss-of-function mutations to a progressive familial intrahepatic cholestasis (PFIC) phenotype featuring neonatal-onset high-GGT cholestasis, congenital hepatic fibrosis, and sclerosing cholangiopathy. (PMID: 33853651)