Tested Applications
| Positive WB detected in | human colon tissue, mouse colon tissue | 
| Positive IHC detected in | mouse pancreas tissue, human colon cancer tissue,  human pancreas tissue,  mouse colon tissue,  mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF-P detected in | mouse small intestine tissue | 
| Positive IF-Fro detected in | mouse small intestine tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:300-1:600 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below | 
| IF | See 1 publications below | 
Product Information
17397-1-AP targets ZG16 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag11332 Product name: Recombinant human ZG16 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-167 aa of BC029149 Sequence: MLTVALLALLCASASGNAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSRC Predict reactive species | 
                                    
| Full Name | zymogen granule protein 16 homolog (rat) | 
| Calculated Molecular Weight | 167 aa, 18 kDa | 
| Observed Molecular Weight | 16 kDa | 
| GenBank Accession Number | BC029149 | 
| Gene Symbol | ZG16 | 
| Gene ID (NCBI) | 653808 | 
| RRID | AB_1939810 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O60844 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Zymogen granule protein 16 (ZG16) has a Jacalin-like lectin domain, which is mainly expressed by mucus-secreting cells, including goblet cells in the intestine. It's reported that ZG16 expression was significantly decreased in colorectal cancer compared to normal tissue. ZG16 gene expression and copy number variations (CNV) were associated with multiple molecular and clinicopathological features of CRC including MSI, MLH1 silencing and so on. It's found that ZG16 is negatively correlated with lymphatic invasive and distant metastasis. Besides, overexpression of ZG16 blocks PD-L1 expression in colorectal cancer, and promotes NK cells survival and proliferation. Very importantly, ZG16 suppresses colorectal tumor growth via the immune system. (PMID: 33360840, 21893569)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZG16 antibody 17397-1-AP | Download protocol | 
| IHC protocol for ZG16 antibody 17397-1-AP | Download protocol | 
| WB protocol for ZG16 antibody 17397-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Nature Co-transplantation of autologous Treg cells in a cell therapy for Parkinson's disease | ||
Adv Sci (Weinh) Gut Dysbiosis Drives Inflammatory Bowel Disease Through the CCL4L2-VSIR Axis in Glycogen Storage Disease | 

























