Tested Applications
| Positive WB detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85023-2-RR targets ZNF517 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag37110 Product name: Recombinant human ZNF517 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 280-390 aa of BC126161 Sequence: QKFHTGEKPFACTECGKAFCRRFTLNEHGRIHSGERPYRCLRCGQRFIRGSSLLKHHRLHAQEGAQDGGAGQGALLGAAQRPQAGDPPHECPVCGRPFRHNSLLLLHLRLH Predict reactive species |
| Full Name | zinc finger protein 517 |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC126161 |
| Gene Symbol | ZNF517 |
| Gene ID (NCBI) | 340385 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6ZMY9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The ZNF family genes are an ancient group of mammalian paralogous homologs, and ZNF517 has been continuously lost during evolution, and although ZNF517 may be involved in transcriptional regulation, its exact function is unknown. A partial deletion and down-regulation of ZNF517 gene expression in cutaneous malignant melanoma (CMM) has been noted.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ZNF517 antibody 85023-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



