ZNF517 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

ZNF517 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85023-2-PBS
Clone No.242576F4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

242576F4, Zinc finger protein 517

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85023-2-PBS targets ZNF517 as part of a matched antibody pair:

MP01773-1: 85023-2-PBS capture and 85023-1-PBS detection (validated in Cytometric bead array)

MP01773-2: 85023-3-PBS capture and 85023-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag37110

Product name: Recombinant human ZNF517 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 280-390 aa of BC126161

Sequence: QKFHTGEKPFACTECGKAFCRRFTLNEHGRIHSGERPYRCLRCGQRFIRGSSLLKHHRLHAQEGAQDGGAGQGALLGAAQRPQAGDPPHECPVCGRPFRHNSLLLLHLRLH

Predict reactive species
Full Name zinc finger protein 517
Observed Molecular Weight50 kDa
GenBank Accession NumberBC126161
Gene Symbol ZNF517
Gene ID (NCBI) 340385
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6ZMY9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The ZNF family genes are an ancient group of mammalian paralogous homologs, and ZNF517 has been continuously lost during evolution, and although ZNF517 may be involved in transcriptional regulation, its exact function is unknown. A partial deletion and down-regulation of ZNF517 gene expression in cutaneous malignant melanoma (CMM) has been noted.

Loading...
||
New chat Able
正在加载,请稍候...