Beta Actin Recombinant monoclonal antibody

Beta Actin Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 81115-1-RR
Clone No.4H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig and More (4)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

ACTB, Actin, bate actin, β actin, 4H1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, rat brain tissue, mouse brain tissue, pig brain tissue
Positive IP detected inHeLa cells
Positive IHC detected inrat colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells, MDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:950-1:3800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81115-1-RR targets Beta Actin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, bovine, goat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14521

Product name: Recombinant human beta actin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-50 aa of BC002409

Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK

Predict reactive species
Full Name actin, beta
Calculated Molecular Weight 375 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC002409
Gene Symbol Beta Actin
Gene ID (NCBI) 60
RRIDAB_2923704
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP60709
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 )

Protocols

Product Specific Protocols
WB protocol for Beta Actin antibody 81115-1-RRDownload protocol
IHC protocol for Beta Actin antibody 81115-1-RRDownload protocol
IF protocol for Beta Actin antibody 81115-1-RRDownload protocol
IP protocol for Beta Actin antibody 81115-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Cell Res

Nonenzymatic lysine D-lactylation induced by glyoxalase II substrate SLG dampens inflammatory immune responses

Authors - Qihang Zhao

Adv Mater

Ultrasound Imaging of Tumor Vascular CD93 with MMRN2 Modified Microbubbles for Immune Microenvironment Prediction

Authors - Dingyi Wang
humanWB

Cell Metab

Lighting up arginine metabolism reveals its functional diversity in physiology and pathology

Authors - Rui Li
mouseWB

Nat Metab

Time of exercise differentially impacts bone growth in mice

Authors - Shaoling Yu

ACS Nano

Long Noncoding RNA URB1-Antisense RNA 1 (AS1) Suppresses Sorafenib-Induced Ferroptosis in Hepatocellular Carcinoma by Driving Ferritin Phase Separation

Authors - Yuan Gao
mouseWB

Nat Commun

A nanoemulsion targeting adipose hypertrophy and hyperplasia shows anti-obesity efficiency in female mice

Authors - Yichao Lu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

YINGJIAN (Verified Customer) (07-24-2025)

In Western blotting, the antibody produced a single, sharp band corresponding to the theoretical size of the target protein, without detectable off-target bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: H9C2 cells, liver
Beta Actin Antibody Western Blot validation (1:5000 dilution) in H9C2 cells, liver (Cat no:81115-1-RR)
FH

Mai Dan (Verified Customer) (02-05-2025)

The antibody doesn't look specific for actin. I observed mainly puncta signal.

  • Applications: Immunofluorescence
  • Cell Tissue Type: rat neurons
FH

Y (Verified Customer) (01-31-2025)

TOP for WB

  • Applications: Western Blot
Loading...