Filter: AllWBIPIHCIF/ICCAffinity

WB analysis using 81115-1-RR (same clone as 81115-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 81115-1-RR (beta actin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.
IP experiment of HeLa using 81115-1-RR (same clone as 81115-1-PBS)
IP result of anti-Beta Actin (IP:81115-1-RR, 4ug; Detection:81115-1-RR 1:5000) with HeLa cells lysate 1400 ug. This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.
IHC staining of rat colon using 81115-1-RR (same clone as 81115-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 81115-1-RR (Beta Actin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.
IHC staining of rat colon using 81115-1-RR (same clone as 81115-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 81115-1-RR (Beta Actin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.
IF Staining of U2OS using 81115-1-RR (same clone as 81115-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed U2OS cells using beta actin antibody (81115-1-RR, Clone: 4H1 ) at dilution of 1:1900 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.
IF Staining of MDCK using 81115-1-RR (same clone as 81115-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed MDCK cells using Beta Actin antibody (81115-1-RR, Clone: 4H1 ) at dilution of 1:4000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 81115-1-RR
Biolayer interferometry (BLl) kinetic assays of 81115-1-RR against Human Beta Actin were performed. The affinity constant is 26.7 nM.

Beta Actin Recombinant monoclonal antibody, PBS Only

Name: Beta Actin Recombinant monoclonal antibody, PBS Only
Brand: Proteintech
SKU: 81115-1-PBS

Beta Actin Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 81115-1-PBS

Clone No.4H1

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

ACTB, Actin, bate actin, β actin, 4H1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (1)

Print datasheet

MSDS SDS

Published Applications

WB	See 1 publications below

Product Information

81115-1-PBS targets Beta Actin in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag14521 Product name: Recombinant human beta actin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002409 Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK Predict reactive species
Full Name	actin, beta
Calculated Molecular Weight	375 aa, 42 kDa
Observed Molecular Weight	42 kDa
GenBank Accession Number	BC002409
Gene Symbol	Beta Actin
Gene ID (NCBI)	60
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P60709
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 )