Beta Actin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Beta Actin Recombinant monoclonal antibody, PBS Only (81115-1-PBS)

Beta Actin Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 81115-1-PBS

Clone No.4H1

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

ACTB, Actin, bate actin, β actin, 4H1

• 

  WB analysis using 81115-1-RR (same clone as 81115-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81115-1-RR (beta actin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 81115-1-RR (same clone as 81115-1-PBS)

  IP result of anti-Beta Actin (IP:81115-1-RR, 4ug; Detection:81115-1-RR 1:5000) with HeLa cells lysate 1400 ug. This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat colon using 81115-1-RR (same clone as 81115-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 81115-1-RR (Beta Actin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat colon using 81115-1-RR (same clone as 81115-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 81115-1-RR (Beta Actin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 81115-1-RR (same clone as 81115-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using beta actin antibody (81115-1-RR, Clone: 4H1 ) at dilution of 1:1900 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MDCK using 81115-1-RR (same clone as 81115-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MDCK cells using Beta Actin antibody (81115-1-RR, Clone: 4H1 ) at dilution of 1:4000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 81115-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 81115-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81115-1-RR against Human Beta Actin were performed. The affinity constant is 26.7 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

81115-1-PBS targets Beta Actin in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14521

  Product name: Recombinant human beta actin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC002409

  Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK

• Full Name: actin, beta
• Calculated Molecular Weight: 375 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC002409
• Gene Symbol: Beta Actin
• Gene ID (NCBI): 60
• RRID: AB_2923704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P60709
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 )

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Eur J Pharmacol; Icariside II suppresses bladder cancer progression via endoplasmic reticulum stress-mediated autophagy and lysosomal dysfunction.; Authors - Jinhua Wang
mouse	WB	Free Radic Biol Med; lncRNA-driven multi-omics reconstitution engineers EVs for macrophage-targeted and anti-inflammatory therapy in MASLD.; Authors - Lin Liu
mouse	WB	J Ethnopharmacol; Broussonetia papyrifera fruit extract attenuates Alzheimer's pathogenesis via disrupting the vicious cycle of Aβ and oxidative stress in C. elegans and cellular models.; Authors - Wen-Bo Cui
human,mouse	WB,IHC	Cell Rep Med; Intestinal Lachnospiraceae bacterium-derived propionate inhibits the progression of clear cell renal cell carcinoma.; Authors - Jun-Yao Xu