cIAP1 Monoclonal antibody

cIAP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66626-1-Ig
Clone No.1H3F1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, ELISA

API1, BIRC2, MIHB, RNF48, 1H3F1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HEK-293 cells, HepG2 cells, Hela cells, Jurkat cells, HSCT6 cells, pig brain tissue, rat brain tissue, mouse skeletal muscle tissue
Positive IHC detected inhuman spleen tissue, human tonsillitis tissue, human lung cancer tissue, human lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66626-1-Ig targets cIAP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21398

Product name: Recombinant human cIAP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 95-196 aa of BC016174

Sequence: LGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPL

Predict reactive species
Full Name baculoviral IAP repeat-containing 2
Calculated Molecular Weight 618 aa, 70 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC016174
Gene Symbol cIAP1
Gene ID (NCBI) 329
RRIDAB_2881986
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13490
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BIRC2 (also known as cIAP1) is a member of the inhibitor of apoptosis protein (IAP) family. The inhibitor of apoptosis (IAP) proteins are a family of anti-apoptotic regulators found in viruses and metazoans. BIRC2 is a nuclear shuttling protein, whose subcellular localization is mediated by the CRM1-dependent nuclear export pathway (PMID: 15265700). The protein is regulated transcriptionally and can be inhibited by mitochondrial proteins released in the cytoplasm upon apoptotic stimuli (PMID: 15187025). BIRC2 is also believed to be a critical regulator of vascular integrity and endothelial cell survival, thereby providing an additional target pathway for the control of angiogenesis and blood vessel homeostasis during embryogenesis, regeneration and tumorigenesis (PMID: 17934460).

Protocols

Product Specific Protocols
IF protocol for cIAP1 antibody 66626-1-IgDownload protocol
IHC protocol for cIAP1 antibody 66626-1-IgDownload protocol
WB protocol for cIAP1 antibody 66626-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Death Dis

Cellular FLICE-like inhibitory protein (cFLIP) critically maintains apoptotic resistance in human lens epithelial cells.

Authors - Jingru Huangfu
humanWB

Chem Biol Interact

Hsa_circ_0005050 interacts with ILF3 and affects cell apoptosis and proliferation by disrupting the balance between p53 and p65

Authors - Jingwen Tan
mouse,humanWB,IP,IHC,IF

J Exp Clin Cancer Res

TRIM56 promotes malignant progression of glioblastoma by stabilizing cIAP1 protein

Authors - Xu Yang
mouseWB,IF

JACC Basic Transl Sci

Bag3 Regulates Mitochondrial Function and the Inflammasome Through Canonical and Noncanonical Pathways in the Heart

Authors - JuFang Wang
mouse,humanWB

Mol Cell

Palmitoylation licenses RIPK1 kinase activity and cytotoxicity in the TNF pathway

Authors - Na Zhang
humanWB

Ecotoxicol Environ Saf

Arsenic-induced circASXL1 regulates 16HBE cell proliferation through the P65 signaling axis

Authors - Xuefei Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Shubham (Verified Customer) (10-04-2019)

Good

  • Applications: Immunoprecipitation,
  • Cell Tissue Type: AC16
cIAP1 Antibody Immunoprecipitation, validation ( dilution) in AC16 (Cat no:66626-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...