CoraLite® Plus 488-conjugated cIAP1 Monoclonal antibody

cIAP1 Monoclonal Antibody for IF/ICC
Cat No. CL488-66626
Clone No.1H3F1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

IF/ICC

API1, BIRC2, C IAP1, cIAP1, Hiap 2, HIAP2, IAP 2, IAP homolog B, IAP2, MIHB, RING finger protein 48, RNF48

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66626 targets cIAP1 in IF/ICC applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21398

Product name: Recombinant human cIAP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 95-196 aa of BC016174

Sequence: LGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPL

Predict reactive species
Full Name baculoviral IAP repeat-containing 2
Calculated Molecular Weight 618 aa, 70 kDa
GenBank Accession NumberBC016174
Gene Symbol cIAP1
Gene ID (NCBI) 329
RRIDAB_2919353
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13490
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BIRC2 (also known as cIAP1) is a member of the inhibitor of apoptosis protein (IAP) family. The inhibitor of apoptosis (IAP) proteins are a family of anti-apoptotic regulators found in viruses and metazoans. BIRC2 is a nuclear shuttling protein, whose subcellular localization is mediated by the CRM1-dependent nuclear export pathway (PMID: 15265700). The protein is regulated transcriptionally and can be inhibited by mitochondrial proteins released in the cytoplasm upon apoptotic stimuli (PMID: 15187025). BIRC2 is also believed to be a critical regulator of vascular integrity and endothelial cell survival, thereby providing an additional target pathway for the control of angiogenesis and blood vessel homeostasis during embryogenesis, regeneration and tumorigenesis (PMID: 17934460).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 cIAP1 antibody CL488-66626Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...