Product Information
84779-4-PBS targets cIAP2 in WB, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag20500 Product name: Recombinant human BIRC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 78-169 aa of BC027485 Sequence: RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE Predict reactive species |
| Full Name | baculoviral IAP repeat-containing 3 |
| Calculated Molecular Weight | 604 aa, 68 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC027485 |
| Gene Symbol | cIAP2 |
| Gene ID (NCBI) | 330 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q13489 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
cIAP2 also known as BIRC3, is a member of the Inhibitor of Apoptosis Protein (IAP) family. cIAP2 is induced by inflammatory stimuli and plays a critical role in regulating adaptive and innate immune responses, cell death, and the production of inflammatory mediators. Its dysregulation is associated with various diseases, including cancer and neuroinflammatory conditions. Understanding the mechanisms by which cIAP2 functions and interacts with other cellular components is essential for developing targeted therapies.







