Tested Applications
| Positive WB detected in | Daudi cells, Raji cells |
| Positive IP detected in | Raji cells |
| Positive FC (Intra) detected in | Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84779-4-RR targets cIAP2 in WB, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag20500 Product name: Recombinant human BIRC3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 78-169 aa of BC027485 Sequence: RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE Predict reactive species |
| Full Name | baculoviral IAP repeat-containing 3 |
| Calculated Molecular Weight | 604 aa, 68 kDa |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC027485 |
| Gene Symbol | cIAP2 |
| Gene ID (NCBI) | 330 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q13489 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
cIAP2 also known as BIRC3, is a member of the Inhibitor of Apoptosis Protein (IAP) family. cIAP2 is induced by inflammatory stimuli and plays a critical role in regulating adaptive and innate immune responses, cell death, and the production of inflammatory mediators. Its dysregulation is associated with various diseases, including cancer and neuroinflammatory conditions. Understanding the mechanisms by which cIAP2 functions and interacts with other cellular components is essential for developing targeted therapies.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for cIAP2 antibody 84779-4-RR | Download protocol |
| IP protocol for cIAP2 antibody 84779-4-RR | Download protocol |
| WB protocol for cIAP2 antibody 84779-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







