Tested Applications
| Positive WB detected in | Recombinant protein |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
60158-1-Ig targets luciferase in WB, ELISA applications and shows reactivity with samples.
| Tested Reactivity | |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13000 Product name: Recombinant dNGLUC protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-185 aa of AY015993 Sequence: MGVKVLFALICIAVAEAKPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGD Predict reactive species |
| Full Name | luciferase |
| Calculated Molecular Weight | 20 kDa |
| GenBank Accession Number | AY015993 |
| Gene Symbol | |
| Gene ID (NCBI) | |
| RRID | AB_10665950 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Luciferase is a generic term for the class of oxidative enzymes used in bioluminescence and is distinct from a photoprotein. The immunogen of this antibody the luciferase(AY015993) from the copepod marine organism Gaussia princeps. This antibody is a McAb to Luciferase.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for luciferase antibody 60158-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
PLoS One Multiplex Assay for Live-Cell Monitoring of Cellular Fates of Amyloid-β Precursor Protein (APP). | ||
Mol Ther Protein expression/secretion boost by a novel unique 21-mer cis-regulatory motif (Exin21) via mRNA stabilization |

