Tested Applications
| Positive WB detected in | SGC-7901 cells |
| Positive IHC detected in | human colon Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IF | See 1 publications below |
| ELISA | See 1 publications below |
Product Information
28492-1-AP targets Filamin-C in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29328 Product name: Recombinant human filamin-c protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2161-2248 aa of NM_001458 Sequence: DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGL Predict reactive species |
| Full Name | filamin C, gamma (actin binding protein 280) |
| Calculated Molecular Weight | 291 kDa |
| Observed Molecular Weight | 280-300 kDa |
| GenBank Accession Number | NM_001458 |
| Gene Symbol | FLNC |
| Gene ID (NCBI) | 2318 |
| RRID | AB_2918171 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14315 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Filamin C (FLNC; also known as γ-FLN; ABP-L; FLN2), a muscle-specific filamin and a large actin-cross-linking protein. Human filamins are ~280 kDa homodimers, each monomer consisting of an N-terminal actin-binding domain followed by 24 immunoglobulin (Ig)-like domains (d1 to d24), the last of which mediates dimerization. FLNC is specifically expressed in cardiomyocytes and skeletal myocytes and is involved in the maintenance of structural integrity. High filamin C associated with better prognosis of prostate cancer, leukemia and breast cancer patients. ( PMID: 25577646, PMID: 30867563, PMID: 31131323)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Filamin-C antibody 28492-1-AP | Download protocol |
| WB protocol for Filamin-C antibody 28492-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Transl Med Spatial transcriptomics and multi-omics reveal relapse and resistance mechanisms of EndMT-derived CAFs mediated by TNC and FLNC in glioblastoma | ||
Int Immunopharmacol Identification of therapeutic targets and immune landscape in glioblastoma through crosstalk with glioma-associated mesenchymal stem cells
| ||
Int J Mol Sci A Regulator Role for the ATP-Binding Cassette Subfamily C Member 6 Transporter in HepG2 Cells: Effect on the Dynamics of Cell-Cell and Cell-Matrix Interactions |



