Tested Applications
Positive WB detected in | HT-29 cells, HUVEC cells, T-47D cells, mouse heart tissue, MCF-7 cells, rat heart tissue |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells, HeLa cells, A431 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IF | See 2 publications below |
Product Information
27872-1-AP targets Gamma Catenin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27394 Product name: Recombinant human JUP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 669-745 aa of BC000441 Sequence: TNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA Predict reactive species |
Full Name | junction plakoglobin |
Observed Molecular Weight | 82 kDa |
GenBank Accession Number | BC000441 |
Gene Symbol | Gamma Catenin |
Gene ID (NCBI) | 3728 |
RRID | AB_2881000 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P14923 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Gamma Catenin antibody 27872-1-AP | Download protocol |
IHC protocol for Gamma Catenin antibody 27872-1-AP | Download protocol |
IF protocol for Gamma Catenin antibody 27872-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Oncol (Dordr) The POU2F1/miR-4490/USP22 axis regulates cell proliferation and metastasis in gastric cancer. | ||
BMC Cancer Systematic optimization and evaluation of culture conditions for the construction of circulating tumor cell clusters using breast cancer cell lines | ||
Int J Biol Macromol Frameshift variants in the C-terminal of CTNNB1 cause familial exudative vitreoretinopathy by AXIN1-mediated ubiquitin-proteasome degradation condensation |