Gamma Catenin Polyclonal antibody

• 

  WB analysis using 27872-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27872-1-AP (Gamma Catenin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27872-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27872-1-AP (gamma catenin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HUVEC using 27872-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 27872-1-AP (gamma catenin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27872-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27872-1-AP (gamma catenin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 27872-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27872-1-AP (Gamma Catenin antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 27872-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27872-1-AP (Gamma Catenin antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 27872-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 27872-1-AP (gamma catenin antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of A431 using 27872-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using Gamma Catenin antibody (27872-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of MCF-7 using 27872-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Gamma Catenin antibody (27872-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red).

• 

  IF Staining of MCF-7 using 27872-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using 27872-1-AP (gamma catenin antibody) at dilution of 1:100 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Gamma Catenin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27872-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

JUP, JUP/gamma Catenin, γ-Catenin, ARVD12, Catenin gamma

---

Tested Applications

• Positive WB detected in: HT-29 cells, HUVEC cells, T-47D cells, mouse heart tissue, MCF-7 cells, rat heart tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells, HeLa cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 2 publications below

Product Information

27872-1-AP targets Gamma Catenin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27394

  Product name: Recombinant human JUP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 669-745 aa of BC000441

  Sequence: TNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA

• Full Name: junction plakoglobin
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: BC000441
• Gene Symbol: Gamma Catenin
• Gene ID (NCBI): 3728
• RRID: AB_2881000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14923
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Oncol (Dordr); The POU2F1/miR-4490/USP22 axis regulates cell proliferation and metastasis in gastric cancer.; Authors - Yizhi Xiao
human	WB,IF	BMC Cancer; Systematic optimization and evaluation of culture conditions for the construction of circulating tumor cell clusters using breast cancer cell lines; Authors - Jueyao Zou
human	WB,IF	Int J Biol Macromol; Frameshift variants in the C-terminal of CTNNB1 cause familial exudative vitreoretinopathy by AXIN1-mediated ubiquitin-proteasome degradation condensation; Authors - Yining Liu