CoraLite®594-conjugated Gamma Tubulin Monoclonal antibody

Gamma Tubulin Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-66320
Clone No.3F9H8

Host / Isotype

Mouse / IgG2a

Reactivity

human, canine

Applications

IF/ICC, FC (Intra)

TUBG1, 3F9H8, Gamma-1-tubulin, Gamma-tubulin complex component 1, GCP-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMDCK cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66320 targets Gamma Tubulin in IF/ICC, FC (Intra) applications and shows reactivity with human, canine samples.

Tested Reactivity human, canine
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23913

Product name: Recombinant human tubulin-gamma protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 150-451 aa of BC000619

Sequence: GSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ

Predict reactive species
Full Name tubulin, gamma 1
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 48-55 kDa
GenBank Accession NumberBC000619
Gene Symbol Gamma Tubulin
Gene ID (NCBI) 7283
RRIDAB_2883556
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23258
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.

Protocols

Product Specific Protocols
FC protocol for CL594 Gamma Tubulin antibody CL594-66320Download protocol
IF protocol for CL594 Gamma Tubulin antibody CL594-66320Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...