"Gamma Tubulin Antibodies" Comparison
View side-by-side comparison of Gamma Tubulin antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | NCCIT cells, HepG2 cells, EC109 cells, K-562 cells, HSCT6 cells, NIH3T3 cells |
| Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MDCK cells, HeLa cells, A549 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66320-1-Ig targets Gamma Tubulin in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23913 Product name: Recombinant human tubulin-gamma protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 150-451 aa of BC000619 Sequence: GSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ Predict reactive species |
| Full Name | tubulin, gamma 1 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 48-55 kDa |
| GenBank Accession Number | BC000619 |
| Gene Symbol | Gamma Tubulin |
| Gene ID (NCBI) | 7283 |
| RRID | AB_2857350 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P23258 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Gamma Tubulin antibody 66320-1-Ig | Download protocol |
| IF protocol for Gamma Tubulin antibody 66320-1-Ig | Download protocol |
| IHC protocol for Gamma Tubulin antibody 66320-1-Ig | Download protocol |
| WB protocol for Gamma Tubulin antibody 66320-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-γ-Tubulin antibody (Cat# 66320-1-Ig) has accumulated 40 citations. These appear in high-impact journals including Nature, Nature Communications, PNAS, Cell Reports, EMBO Molecular Medicine, Cell Death & Disease, Journal of Cell Biology, and eLife. Associated research fields encompass centrosome and primary cilia biology, cancer (colorectal, lung, glioblastoma, endometrial), neurodevelopmental disorders, mitosis and cell cycle, Hedgehog signaling, Parkinson's disease, and vascular biology.
| Species | Application | Title |
|---|---|---|
Nat Commun Competitive antagonism of KAT7 crotonylation against acetylation affects procentriole formation and colorectal tumorigenesis | ||
J Nanobiotechnology GRP75-driven, cell-cycle-dependent macropinocytosis of Tat/pDNA-Ca2+ nanoparticles underlies distinct gene therapy effect in ovarian cancer. | ||
Cell Death Dis The phosphorylation of PHF5A by TrkA-ERK1/2-ABL1 cascade regulates centrosome separation | ||
Cell Death Dis PAK6 rescues pathogenic LRRK2-mediated ciliogenesis and centrosomal cohesion defects in a mutation-specific manner | ||
Cell Death Discov KIFC1 depends on TRIM37-mediated ubiquitination of PLK4 to promote centrosome amplification in endometrial cancer |
Reviews
What customers say
Based on the available reviews, this antibody received a 5-star rating from a user who applied it for immunofluorescence on primary myoblasts at a 1:200 dilution. The reviewer reported that it works well and is suitable for both immunofluorescence and expansion microscopy, using cold methanol fixation. Overall, the feedback is positive, highlighting reliable performance in IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lola (Verified Customer) (10-23-2025) | This antibody works well. Suitable for immunofluorescence and expansion microscopy. We use cold MeOH fixation.
![]() |


























