Tested Applications
Positive WB detected in | Transfected HEK-293 cells |
Positive IF/ICC detected in | Transfected HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
CoIP | See 1 publications below |
Product Information
68088-1-Ig targets mCherry in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with recombinant protein samples.
Tested Reactivity | recombinant protein |
Cited Reactivity | human, pig |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25320 Product name: Recombinant mCherry protein Source: e coli.-derived, PGEX-4T Tag: GST Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Predict reactive species |
Full Name | mCherry |
Calculated Molecular Weight | 27 kDa |
Gene Symbol | |
Gene ID (NCBI) | |
RRID | AB_2918825 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
mCherry is a fluorophore (a fluorescent protein) used in biotechnology as a tracer to follow the flow of fluids, as a marker when tagged to molecules and cell components. mCherry is the second generation monomeric red fluorescent protein that have improved brightness and photostability. mCherry and the majority of red fluorescent proteins derive from a protein isolated from Discosoma sp. mCherry is a monomeric fluorescent construct with peak absorption/emission at 587 nm and 610 nm, respectively.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for mCherry antibody 68088-1-Ig | Download protocol |
IF protocol for mCherry antibody 68088-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Open Biol Coiled-coil-mediated dimerization of Atg16 is required for binding to the PROPPIN Atg21 | ||
J Virol Swine RNF5 positively regulates the antiviral activity of IFITM1 by mediating the degradation of ABHD16A | ||
J Biol Chem Porcine IKKε is involved in the STING-induced type I IFN antiviral response of the cytosolic DNA signaling pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Olga (Verified Customer) (04-09-2025) | Very clear and strong signal in Western blot.
![]() |
FH Christine (Verified Customer) (10-02-2024) | We are running out of a home-made sheep anti RFP antibody and trying to find a replacement. I ran samples transfected with a mCHERRY-tagged protein side by side to compare our old antibody and this one. Although I detected clearly the expression of the mCHERRY tagged protein with this antibody, it was not as sensitive as the sheep one we had and there were some bands of my protein of interest that I could not detect clearly. Upping the concentration from 1:5,000 to 1:1,000 did not make any clear difference. So although the antibody works it is not sensitive enough for my needs.
|