mCherry Monoclonal antibody

mCherry Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 68088-1-Ig
Clone No.1B3C6

Host / Isotype

Mouse / IgG1

Reactivity

recombinant protein and More (2)

Applications

WB, IF/ICC, IP, CoIP, ELISA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTransfected HEK-293 cells
Positive IF/ICC detected inTransfected HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68088-1-Ig targets mCherry in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with recombinant protein samples.

Tested Reactivity recombinant protein
Cited Reactivityhuman, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25320

Product name: Recombinant mCherry protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-235 aa of

Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Predict reactive species
Full Name mCherry
Calculated Molecular Weight 27 kDa
Gene Symbol
Gene ID (NCBI)
RRIDAB_2918825
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

mCherry is a fluorophore (a fluorescent protein) used in biotechnology as a tracer to follow the flow of fluids, as a marker when tagged to molecules and cell components. mCherry is the second generation monomeric red fluorescent protein that have improved brightness and photostability. mCherry and the majority of red fluorescent proteins derive from a protein isolated from Discosoma sp. mCherry is a monomeric fluorescent construct with peak absorption/emission at 587 nm and 610 nm, respectively.

Protocols

Product Specific Protocols
IF protocol for mCherry antibody 68088-1-IgDownload protocol
WB protocol for mCherry antibody 68088-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanCoIP

Open Biol

Coiled-coil-mediated dimerization of Atg16 is required for binding to the PROPPIN Atg21

Authors - Miranda Bueno-Arribas
pigWB

J Virol

Swine RNF5 positively regulates the antiviral activity of IFITM1 by mediating the degradation of ABHD16A

Authors - Xuemeng Shi
humanWB,IP,IF

J Biol Chem

Porcine IKKε is involved in the STING-induced type I IFN antiviral response of the cytosolic DNA signaling pathway

Authors - Jia Luo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Olga (Verified Customer) (04-09-2025)

Very clear and strong signal in Western blot.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Neuro2A, mouse primary neurons
mCherry Antibody Western Blot validation (1:5000 dilution) in Neuro2A, mouse primary neurons (Cat no:68088-1-Ig)
FH

Christine (Verified Customer) (10-02-2024)

We are running out of a home-made sheep anti RFP antibody and trying to find a replacement. I ran samples transfected with a mCHERRY-tagged protein side by side to compare our old antibody and this one. Although I detected clearly the expression of the mCHERRY tagged protein with this antibody, it was not as sensitive as the sheep one we had and there were some bands of my protein of interest that I could not detect clearly. Upping the concentration from 1:5,000 to 1:1,000 did not make any clear difference. So although the antibody works it is not sensitive enough for my needs.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5,000-1:1,000
  • Cell Tissue Type: Transfected HEK293T
Loading...
||
New chat Able
正在加载,请稍候...