p19 INK4d Polyclonal antibody, PBS Only

• 

  WB analysis using 10272-2-AP (same clone as 10272-2-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10272-2-AP (p19 INK4d antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10272-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10272-2-AP (same clone as 10272-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10272-2-AP (p19 INK4d antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10272-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10272-2-AP (same clone as 10272-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10272-2-AP (p19 INK4d antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10272-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

p19 INK4d Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10272-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10272-2-PBS targets p19 INK4d in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0415

  Product name: Recombinant human P19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC001822

  Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

• Full Name: cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC001822
• Gene Symbol: p19 INK4d/CDKN2D
• Gene ID (NCBI): 1032
• RRID: AB_2078742
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55273
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.