p19 INK4d Polyclonal antibody

• 

  WB analysis using 10272-2-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10272-2-AP (p19 INK4d antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 10272-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10272-2-AP (p19 INK4d antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 10272-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10272-2-AP (p19 INK4d antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

p19 INK4d Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10272-2-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CDKN2D, INK4D, P19, p19 INK4D

---

Tested Applications

• Positive WB detected in: mouse testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 13 publications below
• IHC: See 3 publications below

Product Information

10272-2-AP targets p19 INK4d in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0415

  Product name: Recombinant human P19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC001822

  Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

• Full Name: cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC001822
• Gene Symbol: p19 INK4d/CDKN2D
• Gene ID (NCBI): 1032
• RRID: AB_2078742
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55273
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Blood; Interconnecting molecular pathways in the pathogenesis and drug sensitivity of T-cell acute lymphoblastic leukemia.; Authors - Sanda Takaomi T
mouse	WB,IHC	Oxid Med Cell Longev; Resveratrol Inhibits Ischemia-Induced Myocardial Senescence Signals and NLRP3 Inflammasome Activation.; Authors - Hong Feng
human	WB	FASEB J; Overexpression of ERBB4 rejuvenates aged mesenchymal stem cell and enhances angiogenesis via PI3K/AKT and MAPK/ERK pathway.; Authors - Xiaoting Liang
human	WB	Front Immunol; Possible Roles of Proinflammatory Signaling in Keratinocytes Through Aryl Hydrocarbon Receptor Ligands for the Development of Squamous Cell Carcinoma.; Authors - Yota Sato
human	WB	J Virol; Rb-E2F-HDAC Repressor Complexes Control Interferon-Induced Repression of Adenovirus To Promote Persistent Infection.; Authors - Sydney Snaider
mouse	WB	Lab Invest; Th17/IL-17 induces endothelial cell senescence via activation of NF-κB/p53/Rb signaling pathway.; Authors - Liang Zhang