• Featured Product
  • KD/KO Validated

p38 MAPK Recombinant monoclonal antibody, PBS Only

p38 MAPK Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA
Cat No. 80821-2-PBS
Clone No.230263D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

MAPK14, 230263D11, CSAID-binding protein, CSBP, CSBP1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80821-2-PBS targets p38 MAPK in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5115

Product name: Recombinant human p38 MAPK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-307 aa of BC031574

Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

Predict reactive species
Full Name mitogen-activated protein kinase 14
Calculated Molecular Weight 360 aa, 41 kDa
Observed Molecular Weight38-42 kDa
GenBank Accession NumberBC031574
Gene Symbol p38 MAPK
Gene ID (NCBI) 1432
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16539
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...