p38 MAPK Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 80821-2-RR (same clone as 80821-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80821-2-RR (p38 MAPK antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80821-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 80821-2-RR (same clone as 80821-2-PBS)

  WB result of p38 MAPK antibody (80821-2-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-p38 MAPK transfected HepG2 cells. This data was developed using the same antibody clone with 80821-2-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 80821-2-RR (same clone as 80821-2-PBS)

  IP result of anti-p38 MAPK (IP:80821-2-RR, 4ug; Detection:80821-2-RR 1:2000) with HEK-293 cells lysate 1575 ug. This data was developed using the same antibody clone with 80821-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 80821-2-RR (same clone as 80821-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 80821-2-RR (p38 MAPK antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80821-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 80821-2-RR (same clone as 80821-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 80821-2-RR (p38 MAPK antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80821-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 80821-2-RR (same clone as 80821-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using p38 MAPK antibody (80821-2-RR, Clone: 230263D11 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 80821-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 80821-2-RR (same clone as 80821-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Anti-Human p38 MAPK (80821-2-RR, Clone:230263D11) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 80821-2-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 80821-2-RR (same clone as 80821-2-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug Anti-Human p38 MAPK (80821-2-RR, Clone:230263D11) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 80821-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 80821-2-RR

  Biolayer interferometry (BLl) kinetic assays of 80821-2-RR against Human p38 MAPK were performed. The affinity constant is 0.435 nM.

• Featured Product
• KD/KO Validated

p38 MAPK Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 80821-2-PBS

Clone No.230263D11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

MAPK14, 230263D11, CSAID-binding protein, CSBP, CSBP1

---

Product Information

80821-2-PBS targets p38 MAPK in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5115

  Product name: Recombinant human p38 MAPK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-307 aa of BC031574

  Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY

• Full Name: mitogen-activated protein kinase 14
• Calculated Molecular Weight: 360 aa, 41 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC031574
• Gene Symbol: p38 MAPK
• Gene ID (NCBI): 1432
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16539
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing.