p57Kip2 Monoclonal antibody

• 

  WB analysis using 66794-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66794-1-Ig (CDKN1C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66794-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66794-1-Ig (p57Kip2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66794-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66794-1-Ig (CDKN1C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 66794-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66794-1-Ig (p57Kip2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 66794-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66794-1-Ig (p57Kip2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

p57Kip2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66794-1-Ig

Clone No.1A12H3

Publications(8)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CDKN1C, KIP2, p57, Cyclin-dependent kinase inhibitor p57, Cyclin-dependent kinase inhibitor 1C

---

Tested Applications

• Positive WB detected in: HSC-T6 cells, HCT 116 cells, HeLa cells, MDA-MB-231 cells, NIH/3T3 cells, RAW 264.7 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below

Product Information

66794-1-Ig targets p57Kip2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19927

  Product name: Recombinant human CDKN1C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-316 aa of BC067842

  Sequence: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR

• Full Name: cyclin-dependent kinase inhibitor 1C (p57, Kip2)
• Calculated Molecular Weight: 316 aa, 32 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC067842
• Gene Symbol: p57 Kip2/CDKN1C
• Gene ID (NCBI): 1028
• RRID: AB_2882138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49918
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDKN1C, also named as p57KIP2 and KIP2, belongs to the CDI family. CDKN1C is a potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. It is a negative regulator of cell proliferation. CDKN1C may play a role in maintenance of the non-proliferative state throughout life.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Nat Aging; Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer; Authors - Yifei Cheng
mouse	WB	Nat Commun; The transcription factor NF-Y participates to stem cell fate decision and regeneration in adult skeletal muscle.; Authors - Giovanna Rigillo
mouse	WB	Toxicology; Toxicity mechanism of peri-implantation pesticide beta-cypermethrin exposure on endometrial remodeling in early pregnant mice; Authors - Yong-Jiang Zhou
human	WB	J Transl Med; STK40 inhibits trophoblast fusion by mediating COP1 ubiquitination to degrade P57Kip2; Authors - Xia Li
	WB	bioRxiv; D-type cyclins regulate DNA mismatch repair in the G1 and S phases of the cell cycle, maintaining genome stability; Authors - Gergely Rona
human	WB	Mol Cell; CDK-independent role of D-type cyclins in regulating DNA mismatch repair; Authors - Gergely Rona