p57Kip2 Monoclonal antibody

p57Kip2 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66794-1-Ig
Clone No.1A12H3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

CDKN1C, KIP2, p57, Cyclin-dependent kinase inhibitor p57, Cyclin-dependent kinase inhibitor 1C

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHSC-T6 cells, HCT 116 cells, HeLa cells, MDA-MB-231 cells, NIH/3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 8 publications below

Product Information

66794-1-Ig targets p57Kip2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19927

Product name: Recombinant human CDKN1C protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-316 aa of BC067842

Sequence: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR

Predict reactive species
Full Name cyclin-dependent kinase inhibitor 1C (p57, Kip2)
Calculated Molecular Weight 316 aa, 32 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC067842
Gene Symbol p57 Kip2/CDKN1C
Gene ID (NCBI) 1028
RRIDAB_2882138
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49918
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDKN1C, also named as p57KIP2 and KIP2, belongs to the CDI family. CDKN1C is a potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. It is a negative regulator of cell proliferation. CDKN1C may play a role in maintenance of the non-proliferative state throughout life.

Protocols

Product Specific Protocols
IHC protocol for p57Kip2 antibody 66794-1-IgDownload protocol
WB protocol for p57Kip2 antibody 66794-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB

Nat Aging

Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer

Authors - Yifei Cheng
mouseWB

Nat Commun

The transcription factor NF-Y participates to stem cell fate decision and regeneration in adult skeletal muscle.

Authors - Giovanna Rigillo
mouseWB

Toxicology

Toxicity mechanism of peri-implantation pesticide beta-cypermethrin exposure on endometrial remodeling in early pregnant mice

Authors - Yong-Jiang Zhou
humanWB

J Transl Med

STK40 inhibits trophoblast fusion by mediating COP1 ubiquitination to degrade P57Kip2

Authors - Xia Li
WB

bioRxiv

D-type cyclins regulate DNA mismatch repair in the G1 and S phases of the cell cycle, maintaining genome stability

Authors - Gergely Rona
humanWB

Mol Cell

CDK-independent role of D-type cyclins in regulating DNA mismatch repair

Authors - Gergely Rona
Loading...
||
New chat Able
正在加载,请稍候...