p57Kip2 Monoclonal antibody, PBS Only

• 

  WB analysis using 66794-1-Ig (same clone as 66794-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66794-1-Ig (CDKN1C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66794-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66794-1-Ig (same clone as 66794-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66794-1-Ig (p57Kip2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66794-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66794-1-Ig (same clone as 66794-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66794-1-Ig (CDKN1C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66794-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 66794-1-Ig (same clone as 66794-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66794-1-Ig (p57Kip2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66794-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 66794-1-Ig (same clone as 66794-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66794-1-Ig (p57Kip2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66794-1-PBS in a different storage buffer formulation.

p57Kip2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66794-1-PBS

Clone No.1A12H3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CDKN1C, KIP2, p57, Cyclin-dependent kinase inhibitor p57, Cyclin-dependent kinase inhibitor 1C

---

Product Information

66794-1-PBS targets p57Kip2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19927

  Product name: Recombinant human CDKN1C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-316 aa of BC067842

  Sequence: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR

• Full Name: cyclin-dependent kinase inhibitor 1C (p57, Kip2)
• Calculated Molecular Weight: 316 aa, 32 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC067842
• Gene Symbol: p57 Kip2/CDKN1C
• Gene ID (NCBI): 1028
• RRID: AB_2882138
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49918
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDKN1C, also named as p57KIP2 and KIP2, belongs to the CDI family. CDKN1C is a potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. It is a negative regulator of cell proliferation. CDKN1C may play a role in maintenance of the non-proliferative state throughout life.