• Featured Product
  • KD/KO Validated

NF-κB p65 Monoclonal antibody

NF-κB p65 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66535-1-Ig
Clone No.1B12D11

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (5)

Applications

WB, IHC, IF, CoIP, ChIP, RIP, ELISA

NF-kB, NFKB3, NF-κB, NF-κB p65, NF-κB3, p65, RELA, Transcription factor p65

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, MOLT-4 cells, Jurkat cells, Raji cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:150-1:600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66535-1-Ig targets NF-κB p65 in WB, IHC, IF, CoIP, ChIP, RIP, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman, pig, chicken, bovine, hamster
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1199

Product name: Recombinant human p65; RELA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-220 aa of BC011603

Sequence: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ

Predict reactive species
Full Name v-rel reticuloendotheliosis viral oncogene homolog A (avian)
Calculated Molecular Weight 65 kDa
Observed Molecular Weight 65 kDa
GenBank Accession NumberBC011603
Gene Symbol NF-κB p65
Gene ID (NCBI) 5970
RRIDAB_2881898
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ04206
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nuclear factor k B (NF-kB) is a sequence-specific DNA-binding protein complex which regulates the expression of viral genomes, including the human immunodeficiency virus, and a variety of cellular genes, particularly those involved in immune and inflammatory responses. The members of the NF-Kb family in mammalian cells include the proto-oncogene c-Rel,p50/p105 (NFkB1), p65 (RelA), p52/p100 (NFkB2), and RelB. All of these proteins share a conserved 300-amino acid region known as the Rel homology domain which is responsible for DNA binding, dimerization, and nuclear translocation of NF-Kb. The p65 subunit is a major component of NF-Kb complexes and is responsible for trans-activation. NF-kappa-B heterodimeric p65-p50 and p65-c-Rel complexes are transcriptional activators. The NF-kappa-B p65-p65 complex appears to be involved in invasin-mediated activation of IL-8 expression. The inhibitory effect of I-kappa-B upon NF-kappa-B the cytoplasm is exerted primarily through the interaction with p65. p65 shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. It associates with chromatin at the NF-kappa-B promoter region via association with DDX1.

Protocols

Product Specific Protocols
IF protocol for NF-κB p65 antibody 66535-1-IgDownload protocol
IHC protocol for NF-κB p65 antibody 66535-1-IgDownload protocol
WB protocol for NF-κB p65 antibody 66535-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Brain Behav Immun

Egln3 expression in microglia enhances the neuroinflammatory responses in Alzheimer's disease

Authors - Jiaxin Guan
humanChIP

Adv Sci (Weinh)

Elevated SPARC Disrupts the Intestinal Barrier Integrity in Crohn's Disease by Interacting with OTUD4 and Activating the MYD88/NF-κB Pathway

Authors - Jiayu Wang
WB

Adv Healthc Mater

Colon-Targeted Ginseng Polysaccharides-Based Microspheres for Improving Ulcerative Colitis via Anti-Inflammation and Gut Microbiota Modulation

Authors - De-Yang Huo
WB

Cell Rep

METTL3-mediated m6A mRNA methylation regulates neutrophil activation through targeting TLR4 signaling

Authors - Shuhua Luo
WB

Theranostics

Prussian blue nanozyme-mediated nanoscavenger ameliorates acute pancreatitis via inhibiting TLRs/NF-κB signaling pathway.

Authors - Xue Xie
WB

Int J Biol Macromol

Flammulina velutipes polysaccharide exerts immunomodulatory function involving RSAD2 to regulate the NF-κB/MAPK signaling pathway in RAW264.7 macrophage cells and in mouse spleen cells

Authors - Qiuyi Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Udesh (Verified Customer) (04-19-2023)

Lowest membrane part has NF-kB p65 in U2OS cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: U2OS
NF-κB p65 Antibody Western Blot validation (1:1000 dilution) in U2OS (Cat no:66535-1-Ig)
FH

Federica (Verified Customer) (01-16-2023)

The band comes out well even when low total protein concentration is loaded (15 ug).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Dendritic cells
Loading...
||
New chat Able
正在加载,请稍候...