• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® Biotin Anti-Human uPAR/CD87 Rabbit Recombinant Antibody

uPAR/CD87 FcZero-rAb® Recombinant Antibody for FC, ELISA
Cat No. Biotin-FcA98048
Clone No.240366G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC, ELISA

PLAUR, 240366G10, CD87, MO3, U PAR

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  Biotin
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inPMA treated U-937 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98048 targets uPAR/CD87 in FC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0901

Product name: Recombinant Human uPAR/PLAUR protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 23-303 aa of NM_002659.4

Sequence: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYR

Predict reactive species
Full Name PLAUR
Calculated Molecular Weight37 kDa
GenBank Accession NumberNM_002659.4
Gene Symbol uPAR
Gene ID (NCBI) 5329
Conjugate Biotin
Excitation/Emission Maxima Wavelengths-
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ03405-1
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

uPAR, also known as CD87, is a highly glycosylated, GPI-anchored membrane protein. In addition to the membrane-anchored form, uPAR is released from the plasma membrane by cleavage of the GPI anchor and can be found as a soluble form (suPAR). uPAR contains three homologous domains (D1-D3) of which the N-terminal one (D1) represents the uPA-binding domain. After binding to uPAR, uPA cleaves plasminogen, generating the active protease plasmin which is involved in a wide variety of physiologic and pathologic processes. In addition to regulating proteolysis, uPAR has important function in cell adhesion, migration and proliferation. Studies reveal that uPAR expression is elevated during inflammation and tissue remodeling and in many human cancers, in which it frequently indicates poor prognosis. (PMID 20027185; 12461559)

Protocols

Product Specific Protocols
FC protocol for Biotin uPAR/CD87 antibody Biotin-FcA98048Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...