• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® PE Anti-Human uPAR/CD87 Rabbit Recombinant Antibody

uPAR/CD87 FcZero-rAb® Recombinant Antibody for FC
Cat No. PE-FcA98048
Clone No.240366G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

PLAUR, 240366G10, CD87, MO3, U PAR

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  PE
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inPMA treated U-937 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98048 targets uPAR/CD87 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0901

Product name: Recombinant Human uPAR/PLAUR protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 23-303 aa of NM_002659.4

Sequence: LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYR

Predict reactive species
Full Name PLAUR
Calculated Molecular Weight37 kDa
GenBank Accession NumberNM_002659.4
Gene Symbol uPAR
Gene ID (NCBI) 5329
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
Excitation LaserBlue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ03405-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

uPAR, also known as CD87, is a highly glycosylated, GPI-anchored membrane protein. In addition to the membrane-anchored form, uPAR is released from the plasma membrane by cleavage of the GPI anchor and can be found as a soluble form (suPAR). uPAR contains three homologous domains (D1-D3) of which the N-terminal one (D1) represents the uPA-binding domain. After binding to uPAR, uPA cleaves plasminogen, generating the active protease plasmin which is involved in a wide variety of physiologic and pathologic processes. In addition to regulating proteolysis, uPAR has important function in cell adhesion, migration and proliferation. Studies reveal that uPAR expression is elevated during inflammation and tissue remodeling and in many human cancers, in which it frequently indicates poor prognosis. (PMID 20027185; 12461559)

Protocols

Product Specific Protocols
FC protocol for PE uPAR/CD87 antibody PE-FcA98048Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...