ubiquitin Polyclonal antibody

ubiquitin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 10201-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IHC, IF/ICC, FC (Intra), CoIP, ChIP, ELISA

UBB, ubiquitin B, Polyubiquitin B, Polyubiquitin-B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10201-2-AP targets ubiquitin in WB, IHC, IF/ICC, FC (Intra), CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine, monkey, bovine, arabidopsis, trypanosoma cruzi
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0260

Product name: Recombinant human ubiquitin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 104-229 aa of BC000379

Sequence: AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC

Predict reactive species
Full Name ubiquitin B
GenBank Accession NumberBC000379
Gene Symbol ubiquitin
Gene ID (NCBI) 7314
RRIDAB_671515
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP0CG47
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin B (UBB) is a member of ubiquitin family, one of the most conserved proteins known. Ubiquitin B is required for ATP-dependent, non-lysosomal intracellular protein degradation of abnormal proteins and normal proteins with a rapid turnover. Ubiquitin B is covalently bound to proteins to be degraded, and presumably labels these proteins for degradation. Ubiquitin also binds to histone H2A in actively transcribed regions but does not cause histone H2A degradation, suggesting that ubiquitin is also involved in regulation of gene expression.When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. Aberrant form of this protein has been noticed in patients with Alzheimer's and Down syndrome. Interestingly ubiquitin also becomes covalently bonded to many types of pathological inclusions which appear to be resistant to normal degradation.

Protocols

Product Specific Protocols
FC protocol for ubiquitin antibody 10201-2-APDownload protocol
IF protocol for ubiquitin antibody 10201-2-APDownload protocol
IHC protocol for ubiquitin antibody 10201-2-APDownload protocol
WB protocol for ubiquitin antibody 10201-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nature

CLSTN3β enforces adipocyte multilocularity to facilitate lipid utilization

Authors - Kevin Qian
Trypanosoma cruziWB

Nature

Proteasome inhibition for treatment of leishmaniasis, Chagas disease and sleeping sickness.

Authors - Shilpi Khare
WB

Cell Res

NudCL2 is an autophagy receptor that mediates selective autophagic degradation of CP110 at mother centrioles to promote ciliogenesis.

Authors - Min Liu
humanWB,CoIP

Nat Commun

Smooth muscle NF90 deficiency ameliorates diabetic atherosclerotic calcification in male mice via FBXW7-AGER1-AGEs axis

Authors - Fei Xie
WB

Nat Commun

UV-B irradiation-activated E3 ligase GmILPA1 modulates gibberellin catabolism to increase plant height in soybean

Authors - Jiaqi Sun
human

Nat Commun

Stabilization of Pin1 by USP34 promotes Ubc9 isomerization and protein sumoylation in glioma stem cells

Authors - Qiuhong Zhu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

P (Verified Customer) (07-15-2025)

Used for caco2 cells and animal colon tissue

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1 to 1000
FH

David (Verified Customer) (01-02-2024)

Various bands in the soluble fraction, potentially from conjugated proteins, but also clear bands for the ubiquitin monomers.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: SH-SY5Y lysate
FH

Brice-Emmanuel (Verified Customer) (10-12-2023)

Work well

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: Mouse Heart Tissue
ubiquitin Antibody Western Blot validation (1/500 dilution) in Mouse Heart Tissue (Cat no:10201-2-AP)
FH

Brandon (Verified Customer) (03-14-2022)

The antibody works perfectly for ubiquitin located in Human Fibroblast

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HFFs
ubiquitin Antibody Western Blot validation (1:1000 dilution) in HFFs (Cat no:10201-2-AP)
FH

Anita (Verified Customer) (08-06-2021)

10ug protein load from C. elegans

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: C. elegans
ubiquitin Antibody Western Blot validation (1:1000 dilution) in C. elegans (Cat no:10201-2-AP)
FH

Azita (Verified Customer) (06-02-2021)

Western blot analysis using ubiquitin polyclonal antibody in NSC34 cell line at dilution of 1:500.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: NSC34
FH

Robert (Verified Customer) (06-24-2019)

1. reducing conditions2. non-reducing conditions

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: ST cells (porcine)
ubiquitin Antibody Western Blot, validation (1/1000 dilution) in ST cells (porcine) (Cat no:10201-2-AP)
Loading...
||
New chat

Able

正在加载,请稍候...