ubiquitin Recombinant monoclonal antibody

ubiquitin Uni-rAb® Recombinant Antibody for WB, IHC, IHC-Autostainer, IF/ICC, ELISA

Cat No. 80992-1-RR
Clone No.6H6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine, hamster, yeast, spinach

Applications

WB, IHC, IHC-Autostainer, IF/ICC, IP, CoIP, ELISA

UBB, ubiquitin B, 6H6, Polyubiquitin B, Polyubiquitin-B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, MG132 treated NIH/3T3 cells
Positive IHC-Autostainer detected inhuman pancreas tissue
Positive IHC detected inhuman pancreas cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:10000-1:100000
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:50-1:500
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80992-1-RR targets ubiquitin in WB, IHC, IHC-Autostainer, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine, hamster, yeast, spinach samples.

Tested Reactivity human, mouse, rat, canine, hamster, yeast, spinach
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0260

Product name: Recombinant human ubiquitin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 104-229 aa of BC000379

Sequence: AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC

Predict reactive species
Full Name ubiquitin B
GenBank Accession NumberBC000379
Gene Symbol ubiquitin
Gene ID (NCBI) 7314
RRIDAB_2923694
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP0CG47
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin B (UBB) is a member of ubiquitin family, one of the most conserved proteins known. Ubiquitin B is required for ATP-dependent, non-lysosomal intracellular protein degradation of abnormal proteins and normal proteins with a rapid turnover. Ubiquitin B is covalently bound to proteins to be degraded, and presumably labels these proteins for degradation. Ubiquitin also binds to histone H2A in actively transcribed regions but does not cause histone H2A degradation, suggesting that ubiquitin is also involved in regulation of gene expression.When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. Aberrant form of this protein has been noticed in patients with Alzheimer's and Down syndrome. Interestingly ubiquitin also becomes covalently bonded to many types of pathological inclusions which appear to be resistant to normal degradation.

Protocols

Product Specific Protocols
IF protocol for ubiquitin antibody 80992-1-RRDownload protocol
IHC protocol for ubiquitin antibody 80992-1-RRDownload protocol
WB protocol for ubiquitin antibody 80992-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Signal

Repurposing a plant alkaloid homoharringtonine targets insulinoma associated-1 in N-Myc-activated neuroblastoma

Authors - Chiachen Chen
humanIP

Clin Transl Oncol

LncRNA XXYLT1-AS2 promotes tumor progression via autophagy inhibition through ubiquitinated degradation of TFEB in hepatocellular carcinoma

Authors - Xuejie Li
humanWB

Naunyn Schmiedebergs Arch Pharmacol

The METTL3/IGF2BP1 axis-mediated m6 A modification of TRIM11 mRNA suppresses ferroptosis and accelerates malignant progression in non-small cell lung cancer cells by degrading ACSL4

Authors - Haiyang Chen
WB

bioRxiv

Elucidating cancer cachexia-mediated aberrant cardiac wasting signaling in human iPSC-derived cardiac muscle

Authors - Nora Hosny
humanIP

Sci Rep

FBXO2 promotes the progression of papillary thyroid carcinoma through the p53 pathway

Authors - Wenke Guo

Cell Rep

TORC1 autonomously controls its spatial partitioning via the Rag GTPase tether Tco89

Authors - Raffaele Nicastro
Loading...
||
New chat

Able

正在加载,请稍候...