Use Able AI chat for product recommendations

ubiquitin Recombinant monoclonal antibody, PBS Only

ubiquitin Uni-rAb® Recombinant Antibody for WB, IHC, IHC-Autostainer, IF/ICC, Indirect ELISA

Cat No. 80992-1-PBS
Clone No.6H6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine, hamster, yeast, spinach

Applications

WB, IHC, IHC-Autostainer, IF/ICC, Indirect ELISA

UBB, ubiquitin B, 6H6, Polyubiquitin B, Polyubiquitin-B

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80992-1-PBS targets ubiquitin in WB, IHC, IHC-Autostainer, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, canine, hamster, yeast, spinach samples.

Tested Reactivity human, mouse, rat, canine, hamster, yeast, spinach
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0260

Product name: Recombinant human ubiquitin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 104-229 aa of BC000379

Sequence: AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC

Predict reactive species
Full Name ubiquitin B
GenBank Accession NumberBC000379
Gene Symbol ubiquitin
Gene ID (NCBI) 7314
RRIDAB_2923694
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP0CG47
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ubiquitin B (UBB) is a member of ubiquitin family, one of the most conserved proteins known. Ubiquitin B is required for ATP-dependent, non-lysosomal intracellular protein degradation of abnormal proteins and normal proteins with a rapid turnover. Ubiquitin B is covalently bound to proteins to be degraded, and presumably labels these proteins for degradation. Ubiquitin also binds to histone H2A in actively transcribed regions but does not cause histone H2A degradation, suggesting that ubiquitin is also involved in regulation of gene expression.When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. Aberrant form of this protein has been noticed in patients with Alzheimer's and Down syndrome. Interestingly ubiquitin also becomes covalently bonded to many types of pathological inclusions which appear to be resistant to normal degradation.

Loading...
||
New chat

Able

正在加载,请稍候...